CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

OGLUM05G27770 *(Oryza glumaepatula)* GATA
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00320 (GATA)	IPR000679	OGLUM05G27770	T194396_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
GATA19 M06893_2.00	Arabidopsis thaliana	BNGATCBGATY	RATCVGATCNV	Dap-seq OMalley et al.(2016) GATA19_col_a	0.813	0.933
GATA19 M06894_2.00	Arabidopsis thaliana	HNGATCBGATY	RATCVGATCND	Dap-seq OMalley et al.(2016) GATA19_colamp_a	0.813	0.933
GATA20 M06884_2.00	Arabidopsis thaliana	GATCBGAT	ATCVGATC	Dap-seq OMalley et al.(2016) GATA20_col_a	0.802	0.900
GATA20 M06885_2.00	Arabidopsis thaliana	HNGATCNGATBND	HNVATCNGATCND	Dap-seq OMalley et al.(2016) GATA20_colamp_a	0.802	0.900
For this family, TFs with SR scores > 0.802* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
OGLUM05G27770.1	GATA	1	30	MSTPLWRNGPRGPKSLCNACGIRYKKEERR

Links
Other GATA family TFs
Other *Oryza glumaepatula* TFs