CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

PAS_chr3_0418 *(Komagataella pastoris)* GATA
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00320 (GATA)	IPR000679	PAS_chr3_0418	T194626_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
ASH1 M08419_2.00	Saccharomyces cerevisiae	CCYGAYBYGG	CCRVRTCRGG	ChIP-chip Mathelier et al.(2014) MA0276.1	0.850	0.722
ASH1 M08563_2.00	Saccharomyces cerevisiae	YTGAT	ATCAR	Misc DeBoer et al.(2011) YKL185W_28	0.850	0.722
ASH1 M10599_2.00	Saccharomyces cerevisiae	Transfac license required	Transfac license required	Transfac Matys et al.(2006) F$ASH1_01	0.850	0.722
For this family, TFs with SR scores > 0.802* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
CAY70467	GATA	429	465	CISCHSNHSPCWRPSWSALEGQLCNSCGLRYKKTGAR

Links
Other GATA family TFs
Other *Komagataella pastoris* TFs