CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

Rhox11 *(Rattus norvegicus)* Homeodomain
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00046 (Homeobox)	IPR001356	ENSRNOG00000028044	T215456_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
Rhox11 M00510_2.00	Mus musculus	DNWACABNN	NNVTGTWNH	PBM Berger et al.(2008) Rhox11_1765	0.746	0.807
Rhox11 M00511_2.00	Mus musculus	NNWAYABN	NVTRTWNN	PBM Berger et al.(2008) Rhox11_2205	0.746	0.807
Rhox11 M03285_2.00	Mus musculus	DDWACABYD	HRVTGTWHH	SELEX Jolma et al.(2013) Rhox11_1	0.746	0.807
Rhox11 M10769_2.00	Mus musculus	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$RHOX11_02	0.746	0.807
Rhox11 M02100_2.00	Mus musculus	NNNWAYABNN	NNVTRTWNNN	PBM Weirauch et al.(2014) pTH5746	0.714	0.789
For this family, TFs with SR scores > 0.599* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
ENSRNOP00000029223	Homeodomain	97	153	PRKPYKFTPGQLWEMQAVFEETQYPDAFRRKELAELMNVDEQKVKDWFNNKRAKLRK

Links
Other Homeodomain family TFs
Other *Rattus norvegicus* TFs