CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

SELMODRAFT_97273 *(Selaginella moellendorffii)* Homeodomain
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00046 (Homeobox)	IPR001356	SELMODRAFT_97273	T223140_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
estExt_gwp_gw1.C_70211 M02220_2.00	Physcomitrella patens	HMATNANDNN	NNHNTNATKD	PBM Weirauch et al.(2014) pTH8489	0.858	0.893
ATHB-16 M02050_2.00	Arabidopsis thaliana	YAATMATT	AATKATTR	PBM Weirauch et al.(2014) pTH7270	0.829	0.857
ATHB-13 M06900_2.00	Arabidopsis thaliana	HYAATAATTDD	HHAATTATTRD	Dap-seq OMalley et al.(2016) ATHB13_col_a	0.827	0.768
ATHB-13 M06901_2.00	Arabidopsis thaliana	NYAATAATTRW	WYAATTATTRN	Dap-seq OMalley et al.(2016) ATHB13_colamp_a	0.827	0.768
ATHB-6 M02040_2.00	Arabidopsis thaliana	HATNATTDN	NHAATNATD	PBM Weirauch et al.(2014) pTH7670	0.825	0.839
ATHB-6 M06909_2.00	Arabidopsis thaliana	NNNHATKATTR	YAATMATDNNN	Dap-seq OMalley et al.(2016) ATHB6_col_a	0.825	0.839
ATHB-6 M06910_2.00	Arabidopsis thaliana	NCAATAATTRN	NYAATTATTGN	Dap-seq OMalley et al.(2016) ATHB6_colamp_a	0.825	0.839
HAT5 M06914_2.00	Arabidopsis thaliana	NHAATAATTDW	WHAATTATTDN	Dap-seq OMalley et al.(2016) HAT5_col_a	0.813	0.804
HAT5 M06915_2.00	Arabidopsis thaliana	WNYAATAATTRWDN	NHWYAATTATTRNW	Dap-seq OMalley et al.(2016) HAT5_colamp_a	0.813	0.804
HAT5 M02683_2.00	Arabidopsis thaliana	SCAATAATTNNV	BNNAATTATTGS	SELEX Mathelier et al.(2014) MA0008.2	0.813	0.804
HAT5 M10624_2.00	Arabidopsis thaliana	YSCAATAATTNNVN	NBNNAATTATTGSR	Transfac Matys et al.(2006) P$ATHB1_01	0.813	0.804
ATHB-5 M06932_2.00	Arabidopsis thaliana	NYAATMATTND	HNAATKATTRN	Dap-seq OMalley et al.(2016) ATHB5_col_a	0.811	0.804
ATHB-5 M06933_2.00	Arabidopsis thaliana	NYAATMATTN	NAATKATTRN	Dap-seq OMalley et al.(2016) ATHB5_colamp_a	0.811	0.804
ATHB-5 M02684_2.00	Arabidopsis thaliana	CAATVATTGVVSV	BSBBCAATBATTG	SELEX Mathelier et al.(2014) MA0110.2	0.811	0.804
ATHB-5 M10630_2.00	Arabidopsis thaliana	CAATVATTG	CAATBATTG	Transfac Matys et al.(2006) P$ATHB5_01	0.811	0.804
ATHB-21 M06907_2.00	Arabidopsis thaliana	NNWHCAATWATTDN	NHAATWATTGDWNN	Dap-seq OMalley et al.(2016) ATHB21_col_a	0.768	0.696
ATHB-21 M06908_2.00	Arabidopsis thaliana	WWDDNNNHAATWATTGDTNN	NNAHCAATWATTDNNNHHWW	Dap-seq OMalley et al.(2016) ATHB21_colamp_a	0.768	0.696
HB-5 M06924_2.00	Arabidopsis thaliana	NNAHCAATWATTKDNNNHWWH	DWWDNNNHMAATWATTGDTNN	Dap-seq OMalley et al.(2016) ATHB40_col_a	0.766	0.661
HB-5 M06925_2.00	Arabidopsis thaliana	HHAATWATTGDWNN	NNWHCAATWATTDD	Dap-seq OMalley et al.(2016) ATHB40_colamp_a	0.766	0.661
ATHB-53 M06934_2.00	Arabidopsis thaliana	HMAATAATTRD	HYAATTATTKD	Dap-seq OMalley et al.(2016) ATHB53_col_a	0.761	0.625
ATHB-53 M06935_2.00	Arabidopsis thaliana	NNWHCAATWATTDDN	NHHAATWATTGDWNN	Dap-seq OMalley et al.(2016) ATHB53_colamp_a	0.761	0.625
PK20392.1 M01250_2.00	Cannabis sativa	NHAATMATDN	NHATKATTDN	PBM Lambert et al.(2019) pTH11331	0.693	0.768
PK20392.1 M01251_2.00	Cannabis sativa	NHAATMATDN	NHATKATTDN	PBM Lambert et al.(2019) pTH11332	0.693	0.768
ATHB-20 M06912_2.00	Arabidopsis thaliana	HYAATAATTRD	HYAATTATTRD	Dap-seq OMalley et al.(2016) ATHB20_col_a	0.669	0.714
ATHB-20 M06913_2.00	Arabidopsis thaliana	HYAATMATTRD	HYAATKATTRD	Dap-seq OMalley et al.(2016) ATHB20_colamp_a	0.669	0.714
ATHB-51 M00867_2.00	Arabidopsis thaliana	ATWATKNN	NNMATWAT	PBM Franco-Zorrilla et al.(2014) ATHB51	0.602	0.625
ATHB-51 M06927_2.00	Arabidopsis thaliana	DNCAATAATTGAD	HTCAATTATTGNH	Dap-seq OMalley et al.(2016) LMI1_col_a	0.602	0.625
ATHB-51 M06928_2.00	Arabidopsis thaliana	NDNCAATAATTGA	TCAATTATTGNHN	Dap-seq OMalley et al.(2016) LMI1_colamp_a	0.602	0.625
ATHB-22 M02041_2.00	Arabidopsis thaliana	NNATAATWWWNNN	NNNWWWATTATNN	PBM Weirauch et al.(2014) pTH5883	0.599	0.554
For this family, TFs with SR scores > 0.599* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
EFJ26614	Homeodomain	1	56	EKKRRLSVDQVRSLELNFEMENKLEPERKKQLAHELGLQPRQVAVWFQNRRARWKT

Links
Other Homeodomain family TFs
Other *Selaginella moellendorffii* TFs

838 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action
PFICI_10998	Pestalotiopsis fici	PFICI_10998	I	0.000
A1O1_01931	Capronia coronata	A1O1_01931	N	0.000
A1O5_06915	Cladophialophora psammophila	A1O5_06915	N	0.000
A1O7_05076	Cladophialophora yegresii	A1O7_05076	N	0.000
A1O9_13030	Exophiala aquamarina	A1O9_13030	N	0.000
G647_03586	Cladophialophora carrionii	G647_03586	N	0.000
HMPREF1120_03433	Exophiala dermatitidis	HMPREF1120_03433	N	0.000
HMPREF1541_08871	Cyphellophora europaea	HMPREF1541_08871	N	0.000
PV04_04136	Capronia semiimmersa	PV04_04136	N	0.000
PV07_04943	Cladophialophora immunda	PV07_04943	N	0.000
PV08_09016	Exophiala spinifera	PV08_09016	N	0.000
PV11_01942	Exophiala sideris	PV11_01942	N	0.000
Z517_06070	Fonsecaea pedrosoi	Z517_06070	N	0.000
Z519_06584	Cladophialophora bantiana	Z519_06584	N	0.000

SELMODRAFT_97273 (Selaginella moellendorffii) Homeodomain

TF Information

Directly determined binding motifs

Motifs from related TFs

DNA Binding Domains

Links

838 Related TFs

SELMODRAFT_97273 **(Selaginella moellendorffii)
Homeodomain**