CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

Solyc09g008850.2 *(Solanum lycopersicum)* MADF
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF10545 (MADF_DNA_bdg)	IPR006578	Solyc09g008850.2	T249892_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
AT3G10030 M01258_2.00	Arabidopsis thaliana	NRMCGTTAWNN	NNWTAACGKYN	PBM Lambert et al.(2019) pTH11538	0.950	0.819
AT3G10030 M06971_2.00	Arabidopsis thaliana	HRHCKCCGTTANND	HNNTAACGGMGDYD	Dap-seq OMalley et al.(2016) AT3G10030_col_a	0.950	0.819
AT3G10030 M06972_2.00	Arabidopsis thaliana	HWRHMKCCGTTAAHD	HDTTAACGGMKDYWD	Dap-seq OMalley et al.(2016) AT3G10030_colamp_a	0.950	0.819
PK04914.1 M01262_2.00	Cannabis sativa	DCCGTYAN	NTRACGGH	PBM Lambert et al.(2019) pTH10098	0.946	0.764
For this family, TFs with SR scores > 0.812* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Solyc09g008850.2.1	MADF	154	233	CLLEAYMEKFVQLNRGNLRGRDWEEVAVMVSERCEKQSKSVEQCKNKVDNLKKRYKLERHRMSNGGLTISHWPWFKQMEQ

Links
Other MADF family TFs
Other *Solanum lycopersicum* TFs