CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

GLYMA18G47230 *(Glycine max)* Myb/SANT
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00249 (Myb_DNA-binding)	IPR014778	GLYMA18G47230	T271752_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
mybG M02319_2.00	Dictyostelium discoideum	WAATATCT	AGATATTW	PBM Weirauch et al.(2014) pTH5362	0.883	0.913
RVE5 M01079_2.00	Arabidopsis thaliana	NWAATATCHN	NDGATATTWN	PBM Sullivan et al.(2014) pTH7138	0.868	0.978
RVE5 M07100_2.00	Arabidopsis thaliana	NNAAAATATCT	AGATATTTTNN	Dap-seq OMalley et al.(2016) At4g01280_col_a	0.868	0.978
RVE5 M07101_2.00	Arabidopsis thaliana	NNWAAATATCT	AGATATTTWNN	Dap-seq OMalley et al.(2016) At4g01280_colamp_a	0.868	0.978
PK02532.1 M02347_2.00	Cannabis sativa	WAATATCTN	NAGATATTW	PBM Weirauch et al.(2014) pTH9579	0.844	0.913
RVE8 M01074_2.00	Arabidopsis thaliana	NNNRWATCNN	NNGATWYNNN	PBM Sullivan et al.(2014) pTH7136	0.836	0.891
RVE8 M07069_2.00	Arabidopsis thaliana	NHNWAAATATCT	AGATATTTWNDN	Dap-seq OMalley et al.(2016) At3g09600_col_a	0.836	0.891
RVE8 M07070_2.00	Arabidopsis thaliana	NNWAAATATCT	AGATATTTWNN	Dap-seq OMalley et al.(2016) At3g09600_colamp_a	0.836	0.891
RVE4 M07117_2.00	Arabidopsis thaliana	NNWAAATATCT	AGATATTTWNN	Dap-seq OMalley et al.(2016) LCL1_colamp_a	0.836	0.891
RVE4 M07118_2.00	Arabidopsis thaliana	NAAAATATCT	AGATATTTTN	Dap-seq OMalley et al.(2016) LCL1_col	0.836	0.891
RVE6 M01081_2.00	Arabidopsis thaliana	AATATCTD	HAGATATT	PBM Sullivan et al.(2014) pTH7151	0.834	0.891
RVE6 M07138_2.00	Arabidopsis thaliana	NNAAAATATCT	AGATATTTTNN	Dap-seq OMalley et al.(2016) At5g52660_col_a	0.834	0.891
RVE6 M07139_2.00	Arabidopsis thaliana	NNNWAAATATCT	AGATATTTWNNN	Dap-seq OMalley et al.(2016) At5g52660_colamp_a	0.834	0.891
RVE1 M00879_2.00	Arabidopsis thaliana	AAATATCT	AGATATTT	PBM Franco-Zorrilla et al.(2014) RVE1	0.704	0.674
RVE1 M07128_2.00	Arabidopsis thaliana	NNNWAAATATCTNN	NNAGATATTTWNNN	Dap-seq OMalley et al.(2016) RVE1_col_a	0.704	0.674
RVE1 M07129_2.00	Arabidopsis thaliana	NNWAATATCW	WGATATTWNN	Dap-seq OMalley et al.(2016) RVE1_colamp_a	0.704	0.674
PK08316.1 M02350_2.00	Cannabis sativa	NNNRWATCNN	NNGATWYNNN	PBM Weirauch et al.(2014) pTH9488	0.672	0.674
For this family, TFs with SR scores > 0.661* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
GLYMA18G47230.1	Myb	39	84	RENWTDQEHDKFLEALHLFDRDWKKIEAFVGSKTVIQIRSHAQKYF

Links
Other Myb/SANT family TFs
Other *Glycine max* TFs

305 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action
Si012328m.g	Setaria italica	Si012328m.g	N	0.000
Traes_4DS_050789E2A	Triticum aestivum	Traes_4DS_050789E2A	N	0.000
Pavir.Ca01143	Panicum virgatum	Pavir.Ca01143	N	0.000
Pavir.J04205	Panicum virgatum	Pavir.J04205	N	0.000

GLYMA18G47230 (Glycine max) Myb/SANT

TF Information

Directly determined binding motifs

Motifs from related TFs

DNA Binding Domains

Links

305 Related TFs

GLYMA18G47230 **(Glycine max)
Myb/SANT**