CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

Kpol_530p11 *(Vanderwaltozyma polyspora)* Myb/SANT
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00249 (Myb_DNA-binding)	IPR014778	Kpol_530p11	T273527_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
TBF1 M00065_2.00	Saccharomyces cerevisiae	ARCCCTAN	NTAGGGYT	PBM Badis et al.(2008) TBF1_2078	0.817	0.870
TBF1 M01562_2.00	Saccharomyces cerevisiae	NNWRCCCTRN	NYAGGGYWNN	PBM Zhu et al.(2009) Tbf1	0.817	0.870
TBF1 M07492_2.00	Saccharomyces cerevisiae	WRCCCTAN	NTAGGGYW	PBM, CSA and or DIP-chip Mathelier et al.(2014) MA0403.1	0.817	0.870
TBF1 M08597_2.00	Saccharomyces cerevisiae	DHYYAACCCTANBSV	BSVNTAGGGTTRRDH	Misc DeBoer et al.(2011) YPL128C_770	0.817	0.870
TBF1 M11065_2.00	Saccharomyces cerevisiae	Transfac license required	Transfac license required	Transfac Matys et al.(2006) F$TBF1_02	0.817	0.870
TBF1 M11066_2.00	Saccharomyces cerevisiae	Transfac license required	Transfac license required	Transfac Matys et al.(2006) F$TBF1_03	0.817	0.870
For this family, TFs with SR scores > 0.661* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
EDO17041	Myb	405	460	KRTWSKMEEDALIEGLKSFGPSWSKILNLYGAGGKYTEILKNRTQVQLKDKARNWK

Links
Other Myb/SANT family TFs
Other *Vanderwaltozyma polyspora* TFs