CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

POPTR_0008s06450 *(Populus trichocarpa)* Myb/SANT
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00249 (Myb_DNA-binding)	IPR014778	POPTR_0008s06450	T278338_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
AT3G11280 M01075_2.00	Arabidopsis thaliana	NNTTATCNNN	NNNGATAANN	PBM Sullivan et al.(2014) pTH7245	0.801	0.851
AT3G11280 M07074_2.00	Arabidopsis thaliana	DWDWDGATAAKRWW	WWYMTTATCHWHWH	Dap-seq OMalley et al.(2016) At3g11280_col_a	0.801	0.851
AT3G11280 M07075_2.00	Arabidopsis thaliana	NNWNNDGATAAGRWHDNN	NNHDWYCTTATCHNNWNN	Dap-seq OMalley et al.(2016) At3g11280_colamp_a	0.801	0.851
AT5G05790 M07119_2.00	Arabidopsis thaliana	HWYMTTATCHWNWHH	DDWNWDGATAAKRWD	Dap-seq OMalley et al.(2016) At5g05790_col_a	0.672	0.809
PK27213.1 M01284_2.00	Cannabis sativa	NHWATCNNNN	NNNNGATWDN	PBM Lambert et al.(2019) pTH10196	0.665	0.777
PK27213.1 M02356_2.00	Cannabis sativa	NHHATCNNNN	NNNNGATDDN	PBM Weirauch et al.(2014) pTH9600	0.665	0.777
For this family, TFs with SR scores > 0.661* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
POPTR_0008s06450.1	Myb	110	157	GVPWTEEEHRRFLMGLLKHGKGDWRNISRNFVGSKTPTQVASHAQKYF

Links
Other Myb/SANT family TFs
Other *Populus trichocarpa* TFs