CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

Pm005571 *(Prunus mume)* Myb/SANT
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00249 (Myb_DNA-binding)	IPR014778	Pm005571	T283476_2.00	GigaDB (2015-Oct-22)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
GRMZM2G005066 M11056_2.00	Zea mays	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$C1_Q2	0.709	0.710
Q2TCH0_PETHY M11072_2.00	Petunia x hybrida	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$PH4_01	0.706	0.763
MYB4 M02303_2.00	Arabidopsis thaliana	YACCWACY	RGTWGGTR	PBM Weirauch et al.(2014) pTH7075	0.696	0.720
MYB4 M07115_2.00	Arabidopsis thaliana	NYYACCWAMHWHNDD	HHNDWDKTWGGTRRN	Dap-seq OMalley et al.(2016) MYB4_col200_a	0.696	0.720
MYB3 M02288_2.00	Arabidopsis thaliana	NNYACCTACCN	NGGTAGGTRNN	PBM Weirauch et al.(2014) pTH7125	0.687	0.731
MYB62 M07027_2.00	Arabidopsis thaliana	NHRCCTAAYTWNHNN	NNDNWARTTAGGYDN	Dap-seq OMalley et al.(2016) MYB62_col_a	0.678	0.667
MYB62 M07028_2.00	Arabidopsis thaliana	HNKRCCTAACTHH	DDAGTTAGGYMND	Dap-seq OMalley et al.(2016) MYB62_colamp_a	0.678	0.667
MYB108 M07065_2.00	Arabidopsis thaliana	RCCWAAYYNNNNHNH	DNDNNNNRRTTWGGY	Dap-seq OMalley et al.(2016) BOS1_col_a	0.661	0.656
For this family, TFs with SR scores > 0.661* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Pm005571	Myb	45	92	RGPWTAQEDKLLADYIRAHGEGKWSSVPKQAGLKRCGKSCRLRWLNYL
Pm005571	Myb	98	143	RGNITQDEEDLIIRLHKLLGNRWSLIAGRIPGRTDNEIKNYWNTNL

Links
Other Myb/SANT family TFs
Other *Prunus mume* TFs

778 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action
GL12186	Drosophila persimilis	FBgn0149793	N
gw.323.15.1	Branchiostoma floridae	gw.323.15.1	N
BTMF_0000144601	Brugia timori	BTMF_0000144601	N
Hba_20974	Heterorhabditis bacteriophora	Hba_20974	N
HPBE_0000929301	Heligmosomoides bakeri	HPBE_0000929301	N
nLs.2.1.2.g00047	Litomosoides sigmodontis	nLs.2.1.2.g00047	N
SBAD_0000231301	Soboliphyme baturini	SBAD_0000231301	N