CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

Bostr.25219s0206 *(Boechera stricta)* Myb/SANT
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00249 (Myb_DNA-binding)	IPR014778	Bostr.25219s0206	T285779_2.00	JGI:Phytozome (2018-Apr-12)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
TRP5 M01266_2.00	Arabidopsis thaliana	NHWAAACCYH	DRGGTTTWDN	PBM Lambert et al.(2019) pTH9963	0.909	1.000
PK21687.1 M01282_2.00	Cannabis sativa	HWAAACCYH	DRGGTTTWD	PBM Lambert et al.(2019) pTH11299	0.849	0.957
TRP2 M07092_2.00	Arabidopsis thaliana	AAACCCTAAACCCTAAACCC	GGGTTTAGGGTTTAGGGTTT	Dap-seq OMalley et al.(2016) TRP2_col_a	0.841	0.936
TRP2 M07093_2.00	Arabidopsis thaliana	AAACCCTAAACCCTAAACCCT	AGGGTTTAGGGTTTAGGGTTT	Dap-seq OMalley et al.(2016) TRP2_colamp_a	0.841	0.936
TRP1 M07148_2.00	Arabidopsis thaliana	AAACCCTAAACCCTAAACCCTAA	TTAGGGTTTAGGGTTTAGGGTTT	Dap-seq OMalley et al.(2016) TRP1_col	0.831	0.957
For this family, TFs with SR scores > 0.661* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Bostr.25219s0206.1.p	Myb	517	567	RRPFSVAEVEALVQAVERLGTGRWRDVKLRAFDNAKHRTYVDLKDKWKTLV

Links
Other Myb/SANT family TFs
Other *Boechera stricta* TFs