CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

Eucgr.F03176 *(Eucalyptus grandis)* Myb/SANT
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00249 (Myb_DNA-binding)	IPR014778	Eucgr.F03176	T286872_2.00	JGI:Phytozome (2018-Apr-12)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
MYB4 M02303_2.00	Arabidopsis thaliana	YACCWACY	RGTWGGTR	PBM Weirauch et al.(2014) pTH7075	0.698	0.763
MYB4 M07115_2.00	Arabidopsis thaliana	NYYACCWAMHWHNDD	HHNDWDKTWGGTRRN	Dap-seq OMalley et al.(2016) MYB4_col200_a	0.698	0.763
GRMZM2G005066 M11056_2.00	Zea mays	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$C1_Q2	0.696	0.731
Q2TCH0_PETHY M11072_2.00	Petunia x hybrida	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$PH4_01	0.665	0.763
MYB49 M07140_2.00	Arabidopsis thaliana	HDBBYYACCWAMYWH	DWRKTWGGTRRVVHD	Dap-seq OMalley et al.(2016) MYB49_col_a	0.664	0.699
MYB49 M07141_2.00	Arabidopsis thaliana	NYYYACCTAMYWHN	NDWRKTAGGTRRRN	Dap-seq OMalley et al.(2016) MYB49_colamp_a	0.664	0.699
MYB3 M02288_2.00	Arabidopsis thaliana	NNYACCTACCN	NGGTAGGTRNN	PBM Weirauch et al.(2014) pTH7125	0.664	0.742
MYB111 M00882_2.00	Arabidopsis thaliana	NNNAMCDAMY	RKTHGKTNNN	PBM Franco-Zorrilla et al.(2014) MYB111	0.661	0.774
For this family, TFs with SR scores > 0.661* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Eucgr.F03176.1	Myb	14	61	RGAWTAMEDKILTDYIKANGDGKWRNLPKKAGLRRCGKSCRLRWLNYL
Eucgr.F03176.1	Myb	67	112	RGNITLDEEELIIRLHNLLGNRWSLIAGRLPGRTDNEIKNYWNTTI

Links
Other Myb/SANT family TFs
Other *Eucalyptus grandis* TFs

427 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action