CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

Sb01g036590 *(Sorghum bicolor)* NAC/NAM
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF02365 (NAM)	IPR003441	Sb01g036590	T295498_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
ANAC087 M07232_2.00	Arabidopsis thaliana	TDNCKTSHNNNDYACGYHANB	VNTDRCGTRHNNNDSAMGNHA	Dap-seq OMalley et al.(2016) ANAC087_colamp_a	0.897	0.789
ANAC087 M07233_2.00	Arabidopsis thaliana	TWNCKTGWNNNDCAMGYHA	TDRCKTGHNNNWCAMGNWA	Dap-seq OMalley et al.(2016) ANAC087_col_v3a	0.897	0.789
For this family, TFs with SR scores > 0.870* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Sb01g036590.1	NAC/NAM	24	149	PPGFRFHPTDEEIISHYLTHKALNHRFISGVIGEVDLNKCEPWDLPGRAKMGEKEWYFFCHKDRKYPTGTRTNRATETGYWKATGKDKEIFRGRGILVGMKKTLVFYRGRAPRGEKTGWVMHEFRL

Links
Other NAC/NAM family TFs
Other *Sorghum bicolor* TFs