CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

GL25461 *(Drosophila persimilis)* Pipsqueak
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF05225 (HTH_psq)	IPR007889	FBgn0163045	T313699_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
bab1 M06440_2.00	Drosophila melanogaster	AAYAWWWATA	TATWAWTRTT	B1H Zhu et al.(2011) bab1_FlyReg_FBgn0004870	0.956	0.956
bab1 M06441_2.00	Drosophila melanogaster	KAATTAWATAW	WTATWTAATTM	B1H Zhu et al.(2011) bab1_SANGER_5_FBgn0004870	0.956	0.956
bab1 M09690_2.00	Drosophila melanogaster	AHWAYWATAWAHAT	ATDTWTATWRTWDT	Misc Kulakovskiy et al.(2009) bab1	0.956	0.956
For this family, TFs with SR scores > 0.778* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
FBpp0189568	Pipsqueak	331	376	RPEAMAEAIFSVLKEGLSLSQAARKFDIPYPTFVLYANRVHNMLGP

Links
Other Pipsqueak family TFs
Other *Drosophila persimilis* TFs