CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

ENSPFOG00000014257 *(Poecilia formosa)* SAND
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF01342 (SAND)	IPR000770	ENSPFOG00000014257	T321866_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
DEAF1 M11266_2.00	Pan troglodytes	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$DEAF1_01	0.962	0.803
DEAF1 M11267_2.00	Pan troglodytes	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$DEAF1_02	0.962	0.803
For this family, TFs with SR scores > 0.843* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
ENSPFOP00000014331	SAND	166	241	SVYNNELPVRCRNTSGVLYKNRLGSGGKGRCIKHNQQWFAPTEFEALAGRASSKDWKRSIRYAGRPLLCLIQEHIL

Links
Other SAND family TFs
Other *Poecilia formosa* TFs