TF Information

Smad4 *(Mus musculus)* SMAD
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF03165 (MH1)	IPR003619	ENSMUSG00000024515	T324768_2.00	Ensembl (2018-Dec-8)	Link out
NCBI Gene Info: Enables several functions, including DNA-binding transcription activator activity, RNA polymerase II-specific; collagen binding activity; and identical protein binding activity. Involved in several processes, including cell surface receptor signaling pathway; heart development; and positive regulation of protein modification process. Acts upstream of or within several processes, including animal organ development; positive regulation of gonadotropin secretion; and regulation of transcription, DNA-templated. Located in cytoplasm and nucleus. Part of RNA polymerase II transcription regulator complex. Is expressed in several structures, including central nervous system; early conceptus; genitourinary system; immune system; and respiratory system. Used to study juvenile polyposis syndrome and osteogenesis imperfecta. Human ortholog(s) of this gene implicated in several diseases, including female reproductive organ cancer (multiple); hereditary hemorrhagic telangiectasia; juvenile polyposis syndrome; juvenile polyposis-hereditary hemorrhagic telangiectasia syndrome; and seminoma. Orthologous to human SMAD4 (SMAD family member 4). [provided by Alliance of Genome Resources, Apr 2022]
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
Smad4 M05889_2.00	Mus musculus	KCYAGACR	YGTCTRGM	SMiLE-seq Isakova et al.(2017) Smad4	(Direct)	(Direct)
Smad4 M09382_2.00	Mus musculus	DGWGNBAGVCWN	NWGBCTVNCWCH	Misc Kulakovskiy et al.(2013) SMAD4_MOUSE.H11MO.0.A	(Direct)	(Direct)
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
SMAD4 M09377_2.00	Homo sapiens	DRGTGNSAGACWN	NWGTCTSNCACYH	Misc Kulakovskiy et al.(2013) SMAD4_HUMAN.H11MO.0.B	1.000	1.000
SMAD4 M09634_2.00	Homo sapiens	NNNYGTCTGS	SCAGACRNNN	Misc Heinz et al.(2010) ESC-SMAD4_GSE29422	1.000	1.000
SMAD4 M11275_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$SMAD4_Q4	1.000	1.000
SMAD4 M11276_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$SMAD4_Q6_01	1.000	1.000
SMAD4 M11277_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$SMAD4_Q6	1.000	1.000
Med M06447_2.00	Drosophila melanogaster	KCGBCDKKSHVT	ABDSMMHGVCGM	B1H Zhu et al.(2011) Med_FlyReg_FBgn0011655	0.961	0.961
Med M09693_2.00	Drosophila melanogaster	YYBYVYCTGYY	RRCAGRBRVRR	Misc Kulakovskiy et al.(2009) Med	0.961	0.961
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
ENSMUSP00000025393	SMAD	36	137	AKRAIESLVKKLKEKKDELDSLITAITTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFDLKCDSVCVNPYHYERVV
ENSMUSP00000110589	SMAD	36	137	AKRAIESLVKKLKEKKDELDSLITAITTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFDLKCDSVCVNPYHYERVV

Links
Other SMAD family TFs
Other *Mus musculus* TFs

Invalid Input OrderBy

218 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action