CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

Solyc05g032780.1 *(Solanum lycopersicum)* TCP
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF03634 (TCP)	IPR005333	Solyc05g032780.1	T344415_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
TCP4 M02514_2.00	Arabidopsis lyrata	BKGGGACCAC	GTGGTCCCMV	PBM Weirauch et al.(2014) pTH9313	0.915	0.495
TCP3 M02500_2.00	Arabidopsis thaliana	NDGGMCCACN	NGTGGKCCHN	PBM Weirauch et al.(2014) pTH8835	0.913	0.485
TCP3 M07274_2.00	Arabidopsis thaliana	DHNGGGACCACH	DGTGGTCCCNDH	Dap-seq OMalley et al.(2016) TCP3_colamp_a	0.913	0.485
TCP3 M07275_2.00	Arabidopsis thaliana	DNBGGGACCACHN	NDGTGGTCCCVNH	Dap-seq OMalley et al.(2016) TCP3_col	0.913	0.485
TCP4 M02501_2.00	Arabidopsis thaliana	GGGACCAC	GTGGTCCC	PBM Weirauch et al.(2014) pTH8084	0.910	0.485
OS01G0213800 M11398_2.00	Oryza sativa	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$PCF5_01	0.898	0.485
LjT20A21.20.nc M02519_2.00	Lotus japonicus	GGGACCAY	RTGGTCCC	PBM Weirauch et al.(2014) pTH9202	0.870	0.408
TCP13 M07283_2.00	Arabidopsis thaliana	GTGGGGACCACWD	HWGTGGTCCCCAC	Dap-seq OMalley et al.(2016) PTF1_col_a	0.860	0.398
TCP13 M07284_2.00	Arabidopsis thaliana	NNBGGGACCACHN	NDGTGGTCCCVNN	Dap-seq OMalley et al.(2016) PTF1_colamp_a	0.860	0.398
TCP17 M07290_2.00	Arabidopsis thaliana	GTGGGGACCAC	GTGGTCCCCAC	Dap-seq OMalley et al.(2016) TCP17_col_a	0.847	0.398
TCP17 M07291_2.00	Arabidopsis thaliana	RTGGGGACCAC	GTGGTCCCCAY	Dap-seq OMalley et al.(2016) TCP17_colamp_a	0.847	0.398
TCP2 M02503_2.00	Arabidopsis thaliana	NBGGKMCCVN	NBGGKMCCVN	PBM Weirauch et al.(2014) pTH8198	0.845	0.388
TCP2 M02508_2.00	Arabidopsis lyrata	GGSMCCAC	GTGGKSCC	PBM Weirauch et al.(2014) pTH9231	0.845	0.388
TCP5 M02510_2.00	Arabidopsis lyrata	GGGACCAC	GTGGTCCC	PBM Weirauch et al.(2014) pTH9233	0.825	0.388
For this family, TFs with SR scores > 0.822* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Solyc05g032780.1.1	TCP	91	208	TGRKYRHSNVSTAKGPKDRRVRLSPNTAIQFYDVQDRLGYDRPCKAIDSLIKEAKVTIDALGEFPNNFHSTKLNPKKMQYSFDQEQSPEFSQENRGVPNSECGVQDKQQEVNYDIPNM

Links
Other TCP family TFs
Other *Solanum lycopersicum* TFs

353 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action
SELMODRAFT_136689	Selaginella moellendorffii	SELMODRAFT_136689	N

Solyc05g032780.1 (Solanum lycopersicum) TCP

TF Information

Directly determined binding motifs

Motifs from related TFs

DNA Binding Domains

Links

353 Related TFs

Solyc05g032780.1 **(Solanum lycopersicum)
TCP**