CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

Traes_5DS_643EDFE5B *(Triticum aestivum)* TCP
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF03634 (TCP)	IPR005333	Traes_5DS_643EDFE5B	T344475_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
LjT20A21.20.nc M02519_2.00	Lotus japonicus	GGGACCAY	RTGGTCCC	PBM Weirauch et al.(2014) pTH9202	0.920	0.424
TCP2 M02503_2.00	Arabidopsis thaliana	NBGGKMCCVN	NBGGKMCCVN	PBM Weirauch et al.(2014) pTH8198	0.902	0.394
TCP2 M02508_2.00	Arabidopsis lyrata	GGSMCCAC	GTGGKSCC	PBM Weirauch et al.(2014) pTH9231	0.900	0.386
TCP5 M02505_2.00	Arabidopsis thaliana	GGGACCAY	RTGGTCCC	PBM Weirauch et al.(2014) pTH7523	0.900	0.409
TCP5 M02510_2.00	Arabidopsis lyrata	GGGACCAC	GTGGTCCC	PBM Weirauch et al.(2014) pTH9233	0.896	0.379
TCP13 M07283_2.00	Arabidopsis thaliana	GTGGGGACCACWD	HWGTGGTCCCCAC	Dap-seq OMalley et al.(2016) PTF1_col_a	0.885	0.386
TCP13 M07284_2.00	Arabidopsis thaliana	NNBGGGACCACHN	NDGTGGTCCCVNN	Dap-seq OMalley et al.(2016) PTF1_colamp_a	0.885	0.386
PK10344.1 M01313_2.00	Cannabis sativa	GGGACCAC	GTGGTCCC	PBM Lambert et al.(2019) pTH11464	0.884	0.348
TCP4 M02501_2.00	Arabidopsis thaliana	GGGACCAC	GTGGTCCC	PBM Weirauch et al.(2014) pTH8084	0.884	0.424
OS01G0213800 M11398_2.00	Oryza sativa	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$PCF5_01	0.878	0.356
TCP4 M02514_2.00	Arabidopsis lyrata	BKGGGACCAC	GTGGTCCCMV	PBM Weirauch et al.(2014) pTH9313	0.877	0.417
TCP3 M02500_2.00	Arabidopsis thaliana	NDGGMCCACN	NGTGGKCCHN	PBM Weirauch et al.(2014) pTH8835	0.868	0.364
TCP3 M07274_2.00	Arabidopsis thaliana	DHNGGGACCACH	DGTGGTCCCNDH	Dap-seq OMalley et al.(2016) TCP3_colamp_a	0.868	0.364
TCP3 M07275_2.00	Arabidopsis thaliana	DNBGGGACCACHN	NDGTGGTCCCVNH	Dap-seq OMalley et al.(2016) TCP3_col	0.868	0.364
TCP17 M07290_2.00	Arabidopsis thaliana	GTGGGGACCAC	GTGGTCCCCAC	Dap-seq OMalley et al.(2016) TCP17_col_a	0.862	0.371
TCP17 M07291_2.00	Arabidopsis thaliana	RTGGGGACCAC	GTGGTCCCCAY	Dap-seq OMalley et al.(2016) TCP17_colamp_a	0.862	0.371
For this family, TFs with SR scores > 0.822* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Traes_5DS_643EDFE5B.2	TCP	37	241	AGGKDRHSKVVTSRGLRDRRIRLSVQTAIQFYDIQDRLGVDQPSKAIEWLIQAAATAIDGLPSLDCSFALPVASPAAEDAAEVSTSETSKGSVLSLANGPADNDNATHQANAYNGGSANGTFAELLHCSNAADKPMQHQHQQPTLAYYAAPGSHIAPMSFEMIPQLTFSQDQQHRHHHHHHASVAFDRSTLQSNTVSTPQWPPSQ

Links
Other TCP family TFs
Other *Triticum aestivum* TFs

443 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action

Traes_5DS_643EDFE5B (Triticum aestivum) TCP

TF Information

Directly determined binding motifs

Motifs from related TFs

DNA Binding Domains

Links

443 Related TFs

Traes_5DS_643EDFE5B **(Triticum aestivum)
TCP**