CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

TPHA_0B03630 *(Tetrapisispora phaffii)* Zinc cluster
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00172 (Zn_clus)	IPR001138	TPHA_0B03630	T385028_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
HAP1 M00097_2.00	Saccharomyces cerevisiae	HCGGVNNWH	DWNNBCCGD	PBM Badis et al.(2008) HAP1_2139	0.570	0.842
HAP1 M00925_2.00	Saccharomyces cerevisiae	NCGGABWTA	TAWVTCCGN	PBM Gordan et al.(2011) Hap1	0.570	0.842
HAP1 M07523_2.00	Saccharomyces cerevisiae	CGGABWTW	WAWVTCCG	PBM, CSA and or DIP-chip Mathelier et al.(2014) MA0312.1	0.570	0.842
HAP1 M08680_2.00	Saccharomyces cerevisiae	GGMRWTAHCGS	SCGDTAWYKCC	Misc DeBoer et al.(2011) YLR256W_376	0.570	0.842
HAP1 M11481_2.00	Saccharomyces cerevisiae	Transfac license required	Transfac license required	Transfac Matys et al.(2006) F$HAP1_B	0.570	0.842
For this family, TFs with SR scores > 0.537* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
CCE62033	Zinc cluster	43	82	LSCTICRKRKVKCDKTHPHCNQCVKTGVQHLCHYMEQSWA

Links
Other Zinc cluster family TFs
Other *Tetrapisispora phaffii* TFs