CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

fgenesh2_pg.scaffold_585000001 *(Branchiostoma floridae)* AP-2
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF03299 (TF_AP-2)	IPR013854	fgenesh2_pg.scaffold_585000001	T011215_2.00	JGI (2012-Mar-17)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
Tfap2a M00111_2.00	Mus musculus	HSCCBNVRGS	SCYBNVGGSD	PBM Badis et al.(2009) Tcfap2a_2337	0.707	0.707
Tfap2a M02768_2.00	Mus musculus	HGCCYBVRGGCR	YGCCYBVRGGCD	SELEX Jolma et al.(2013) Tcfap2a_1	0.707	0.707
Tfap2a M02769_2.00	Mus musculus	HGCCTSRGGCD	HGCCYSAGGCD	SELEX Jolma et al.(2013) Tcfap2a_2	0.707	0.707
Tfap2a M02770_2.00	Mus musculus	WGCCCYBVGGGCD	HGCCCBVRGGGCW	SELEX Jolma et al.(2013) Tcfap2a_3	0.707	0.707
Tfap2a M08704_2.00	Mus musculus	SCCYCRGGSNNN	NNNSCCYGRGGS	Misc Kulakovskiy et al.(2013) AP2A_MOUSE.H11MO.0.A	0.707	0.707
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
fgenesh2_pg.scaffold_585000001	AP-2	14	133	LLGAELGEAIHLARDFGYVCETEFPAKQVGEFVARQHDPSEVHARKQMIIATKQITKEIQDLLAQDRSPLCNNRPQAILDPNLQRCLTHFCLITHGFGTPALCAAFTALQNYLTEMLKYL

Links
Other AP-2 family TFs
Other *Branchiostoma floridae* TFs