CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

V565_100990 *(Rhizoctonia solani)* APSES
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF04383 (KilA-N)	IPR018004	V565_100990	T012437_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
NCU07587 M01654_2.00	Neurospora crassa	NNNDCRCGN	NCGYGHNNN	PBM Weirauch et al.(2014) pTH9687	0.734	0.684
estExt_fgenesh2_pg.C_10694_CONSTRUCT M01102_2.00	PBM CONSTRUCTS	NNACGCGW	WCGCGTNN	PBM Lambert et al.(2019) pTH9838	0.705	0.632
MBP1 M00003_2.00	Saccharomyces cerevisiae	VACGCGWD	HWCGCGTB	PBM Badis et al.(2008) MBP1_4486	0.688	0.434
MBP1 M01514_2.00	Saccharomyces cerevisiae	NNNNDCRCGH	DCGYGHNNNN	PBM Zhu et al.(2009) Mbp1	0.688	0.434
MBP1 M07434_2.00	Saccharomyces cerevisiae	NDCGCGH	DCGCGHN	PBM, CSA and or DIP-chip Mathelier et al.(2014) MA0329.1	0.688	0.434
MBP1 M08472_2.00	Saccharomyces cerevisiae	NDCGCGH	DCGCGHN	Misc DeBoer et al.(2011) YDL056W_500	0.688	0.434
ANIA_03154 M01650_2.00	Aspergillus nidulans	NNACGCG	CGCGTNN	PBM Weirauch et al.(2014) pTH8232	0.665	0.408
NCU07246 M01653_2.00	Neurospora crassa	NDCRCGN	NCGYGHN	PBM Weirauch et al.(2014) pTH8957	0.655	0.461
For this family, TFs with SR scores > 0.650* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
KEP49410	APSES	29	107	VRGIAVMRRRSDSFVNATQILKVAGIDKGRRTKILEKEILPGKHEIVQGGYGKYQGTWIPLERGRDVAAQYGVASLLSP

Links
Other APSES family TFs
Other *Rhizoctonia solani* TFs