CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

AMTR_s00185p00053620 *(Amborella trichopoda)* BBR
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF06217 (GAGA_bind)	IPR010409	AMTR_s00185p00053620	T024513_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
BPC6 M06719_2.00	Arabidopsis thaliana	KAGAGAGAGAGAGAGAGAGAG	CTCTCTCTCTCTCTCTCTCTM	Dap-seq OMalley et al.(2016) BPC6_col_a	0.894	0.894
BPC5 M06717_2.00	Arabidopsis thaliana	AGAGAGAGAGAGAGAGAGAGAGAGAGAGAG	CTCTCTCTCTCTCTCTCTCTCTCTCTCTCT	Dap-seq OMalley et al.(2016) BPC5_col_a	0.766	0.766
BPC5 M06718_2.00	Arabidopsis thaliana	RRRRVNRRGAGARAGAGAGAGAGAGAGAG	CTCTCTCTCTCTCTCTYTCTCYYNBYYYY	Dap-seq OMalley et al.(2016) BPC5_colamp_a	0.766	0.766
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
ERN14459	BBR	1	94	MPIPVCSCTGVLQQCYKWGNGGWQSACCTTQISMYPLPVMPNKRHARVGGRKMSGSAFTKLLSRLAAEGHDLSVPLDLKDHWAKHGTNRYITIK

Links
Other BBR family TFs
Other *Amborella trichopoda* TFs