CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

L798_01589 *(Zootermopsis nevadensis)* bHLH
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00010 (HLH)	IPR001092	L798_01589	T040717_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
h M03594_2.00	Drosophila melanogaster	YGSCACGCGMMW	WKKCGCGTGSCR	SELEX Nitta et al.(2015) h_1	0.845	0.927
h M06463_2.00	Drosophila melanogaster	GBCRCGYGVC	GBCRCGYGVC	B1H Mathelier et al.(2014) MA0449.1	0.845	0.927
h M05935_2.00	Drosophila melanogaster	GGCRCGYGNC	GNCRCGYGCC	B1H Zhu et al.(2011) h_NAR_FBgn0001168	0.845	0.927
h M05936_2.00	Drosophila melanogaster	GSCACGYGMC	GKCRCGTGSC	B1H Zhu et al.(2011) h_SANGER_5_FBgn0001168	0.845	0.927
h M09656_2.00	Drosophila melanogaster	GVCACGCGHC	GDCGCGTGBC	Misc Kulakovskiy et al.(2009) h	0.845	0.927
h M09891_2.00	Drosophila melanogaster	NNBVCACGCGVSHN	NDSBCGCGTGBVNN	Transfac Matys et al.(2006) I$HAIRY_01	0.845	0.927
For this family, TFs with SR scores > 0.838* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
KDR07936	bHLH	51	108	RRSNKPIMEKRRRARINNCLNELKTLILDAMKKDPARHSKLEKADILEMTVKHLENLQ

Links
Other bHLH family TFs
Other *Zootermopsis nevadensis* TFs