CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

SNOG_05677 *(Stagonospora nodorum)* bZIP
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00170 (bZIP_1)	IPR011616	SNOG_05677	T056236_2.00	Broad (2016-May-1)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
asl-1 M01147_2.00	Neurospora crassa	NVTKACGHNN	NNDCGTMABN	PBM Lambert et al.(2019) pTH8918	0.936	0.891
Atf2 M01808_2.00	Mus musculus	NRTKAYGYMD	HKRCRTMAYN	PBM Weirauch et al.(2014) pTH5083	0.787	0.500
Atf2 M08827_2.00	Mus musculus	VTGACVTCABY	RVTGABGTCAB	Misc Kulakovskiy et al.(2013) ATF2_MOUSE.H11MO.0.A	0.787	0.500
Atf2 M09493_2.00	Mus musculus	NNVTGABVTCAB	VTGABVTCABNN	Misc Heinz et al.(2010) 3T3L1-Atf2_GSE56872	0.787	0.500
For this family, TFs with SR scores > 0.782* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
SNOT_05677	bZIP	424	487	TDEEKRKNFLERNRVAALKCRQRKKQWLANLQAKVELFSTENDALSATVTQLREEIVNLKTLLL

Links
Other bZIP family TFs
Other *Stagonospora nodorum* TFs