CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

Tal_R007501 *(Tyto alba)* bZIP
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00170 (bZIP_1)	IPR011616	Tal_R007501	T070464_2.00	GigaDB (2015-Oct-22)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
ATF1 M08792_2.00	Homo sapiens	HBRCGTCAYHN	NDRTGACGYVD	Misc Kulakovskiy et al.(2013) ATF1_HUMAN.H11MO.0.B	0.906	0.967
ATF1 M09485_2.00	Homo sapiens	NVTGACGTMA	TKACGTCABN	Misc Heinz et al.(2010) K562-ATF1_GSE31477	0.906	0.967
ATF1 M09956_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$ATF1_Q3	0.906	0.967
ATF1 M09957_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$ATF1_Q6_01	0.906	0.967
ATF1 M09958_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$ATF1_Q6	0.906	0.967
Atf1 M00124_2.00	Mus musculus	NNNNDNDNNN	NNNHNHNNNN	PBM Badis et al.(2009) Atf1_3026	0.896	0.967
Atf1 M01804_2.00	Mus musculus	RTGACGTV	BACGTCAY	PBM Weirauch et al.(2014) pTH5005	0.896	0.967
Atf1 M08820_2.00	Mus musculus	VTGACGTSAV	BTSACGTCAB	Misc Kulakovskiy et al.(2013) ATF1_MOUSE.H11MO.0.B	0.896	0.967
Creb1 M00992_2.00	Mus musculus	NNTGACGTCV	BGACGTCANN	PBM Mann et al.(2013) CREB1_UM_HK	0.894	0.900
Creb1 M01806_2.00	Mus musculus	VTKACGHNN	NNDCGTMAB	PBM Weirauch et al.(2014) pTH5080	0.894	0.900
CREB1 M04264_2.00	Homo sapiens	NVTKACGTMABN	NVTKACGTMABN	SELEX Yin et al.(2017) CREB1_FL_HT-SELEX	0.894	0.900
CREB1 M04258_2.00	Homo sapiens	NVTKACGTMANN	NNTKACGTMABN	SELEX Yin et al.(2017) CREB1_eDBD_HT-SELEX_1	0.894	0.900
CREB1 M04259_2.00	Homo sapiens	NRTGACGTR	YACGTCAYN	SELEX Yin et al.(2017) CREB1_eDBD_HT-SELEX_2	0.894	0.900
CREB1 M04260_2.00	Homo sapiens	VTSACRYGWBAY	RTVWCRYGTSAB	SELEX Yin et al.(2017) CREB1_eDBD_HT-SELEX_3	0.894	0.900
CREB1 M04022_2.00	Homo sapiens	NRTGACGTCAYN	NRTGACGTCAYN	SELEX Rodriguez-Martinez et al.(2017) CREB1.1	0.894	0.900
CREB1 M04023_2.00	Homo sapiens	RTGACGTADB	VHTACGTCAY	SELEX Rodriguez-Martinez et al.(2017) CREB1.2	0.894	0.900
CREB1 M08066_2.00	Homo sapiens	NVTGACGTCABN	NVTGACGTCABN	ChIP-seq Mathelier et al.(2014) MA0018.3	0.894	0.900
CREB1 M08791_2.00	Homo sapiens	WKRCGTCAYYN	NRRTGACGYMW	Misc Kulakovskiy et al.(2013) CREB1_HUMAN.H11MO.0.A	0.894	0.900
Creb1 M08824_2.00	Mus musculus	WKRCGTCAYYN	NRRTGACGYMW	Misc Kulakovskiy et al.(2013) CREB1_MOUSE.H11MO.0.A	0.894	0.900
CREB1 M09948_2.00	Homo sapiens	TGACGTMW	WKACGTCA	Transfac Matys et al.(2006) V$CREB_01	0.894	0.900
CREB1 M09949_2.00	Homo sapiens	BBGDTGACGYVV	BBRCGTCAHCVV	Transfac Matys et al.(2006) V$CREB_02	0.894	0.900
CREB1 M09950_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$CREB1_Q3	0.894	0.900
CREB1 M09951_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$CREB1_Q6	0.894	0.900
CREB1 M09952_2.00	Homo sapiens	BSTGACGYARNN	NNYTRCGTCASV	Transfac Matys et al.(2006) V$CREB_Q2	0.894	0.900
CREB1 M09953_2.00	Homo sapiens	BSTGACGYMRBV	BVYKRCGTCASV	Transfac Matys et al.(2006) V$CREB_Q4	0.894	0.900
CREB1 M09954_2.00	Homo sapiens	KKGGGKTGACGYMND	HNKRCGTCAMCCCMM	Transfac Matys et al.(2006) V$TAXCREB_01	0.894	0.900
CREB1 M09955_2.00	Homo sapiens	RTGACGCATAYCCCC	GGGGRTATGCGTCAY	Transfac Matys et al.(2006) V$TAXCREB_02	0.894	0.900
Creb1 M00991_2.00	Mus musculus	NNRTGACGYVN	NBRCGTCAYNN	PBM Mann et al.(2013) CREB1_M_HK	0.894	0.900
CREB1 M04265_2.00	Homo sapiens	NRTGACRTCAYN	NRTGAYGTCAYN	SELEX Yin et al.(2017) CREB1_FL_Methyl-HT-SELEX	0.894	0.900
CREB1 M04261_2.00	Homo sapiens	BRTGAYGYGND	HNCRCRTCAYV	SELEX Yin et al.(2017) CREB1_eDBD_Methyl-HT-SELEX_1	0.894	0.900
CREB1 M04262_2.00	Homo sapiens	NRTGACRTCAYN	NRTGAYGTCAYN	SELEX Yin et al.(2017) CREB1_eDBD_Methyl-HT-SELEX_2	0.894	0.900
CREB1 M04263_2.00	Homo sapiens	NRTGACGYV	BRCGTCAYN	SELEX Yin et al.(2017) CREB1_eDBD_Methyl-HT-SELEX_3	0.894	0.900
Crem M01821_2.00	Mus musculus	NRTKACGTMN	NKACGTMAYN	PBM Weirauch et al.(2014) pTH5002	0.880	0.883
Crem M08845_2.00	Mus musculus	SVVTGACGTSA	TSACGTCABBS	Misc Kulakovskiy et al.(2013) CREM_MOUSE.H11MO.0.C	0.880	0.883
CREM M04229_2.00	Homo sapiens	VVTBACGTVABN	NVTBACGTVABB	SELEX Yin et al.(2017) CREM_eDBD_HT-SELEX	0.849	0.733
CREM M08784_2.00	Homo sapiens	SVVTGACGTSA	TSACGTCABBS	Misc Kulakovskiy et al.(2013) CREM_HUMAN.H11MO.0.C	0.849	0.733
CREM M09930_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$CREM_Q6_01	0.849	0.733
CREM M09931_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$CREM_Q6	0.849	0.733
CREM M04230_2.00	Homo sapiens	NRTGACRTCAYN	NRTGAYGTCAYN	SELEX Yin et al.(2017) CREM_eDBD_Methyl-HT-SELEX	0.849	0.733
CrebB-17A M03659_2.00	Drosophila melanogaster	RTGACGTCAY	RTGACGTCAY	SELEX Nitta et al.(2015) CrebB-17A_1	0.817	0.817
CrebB-17A M03660_2.00	Drosophila melanogaster	RTGACGTCAY	RTGACGTCAY	SELEX Nitta et al.(2015) CrebB-17A_2	0.817	0.817
For this family, TFs with SR scores > 0.782* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Tal_R007501	bZIP	257	316	DPQLKREIRLMKNREAARECRRKKKEYVKCLENRVAVLENQNKTLIEELKTLKDLYCHKS

Links
Other bZIP family TFs
Other *Tyto alba* TFs

360 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action
ENSPSIG00000005026	Pelodiscus sinensis	ENSPSIG00000005026	N
MTERF3	Anolis carolinensis	ENSACAG00000004143	N

Tal_R007501 (Tyto alba) bZIP

TF Information

Directly determined binding motifs

Motifs from related TFs

DNA Binding Domains

Links

360 Related TFs

Tal_R007501 **(Tyto alba)
bZIP**