CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

WUBG_10387 *(Wuchereria bancrofti)* GATA
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00320 (GATA)	IPR000679	WUBG_10387	T191540_2.00	Broad (2016-May-1)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
CBG13549 M01231_2.00	Caenorhabditis briggsae	NTGATAAN	NTTATCAN	PBM Lambert et al.(2019) pTH11492	0.856	0.886
elt-6 M00666_2.00	Caenorhabditis elegans	NTGATAAN	NTTATCAN	PBM Narasimhan et al.(2015) pTH10707	0.851	0.857
For this family, TFs with SR scores > 0.802* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
WUBG_10387T0	GATA	80	114	CSNCLTTKTTAWRRDQTGKLVCNACGLYYRLHRTN

Links
Other GATA family TFs
Other *Wuchereria bancrofti* TFs