CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

Bra003980 *(Brassica rapa)* Homeodomain
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00046 (Homeobox)	IPR001356	Bra003980	T205041_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
ATHB-13 M06900_2.00	Arabidopsis thaliana	HYAATAATTDD	HHAATTATTRD	Dap-seq OMalley et al.(2016) ATHB13_col_a	0.855	0.964
ATHB-13 M06901_2.00	Arabidopsis thaliana	NYAATAATTRW	WYAATTATTRN	Dap-seq OMalley et al.(2016) ATHB13_colamp_a	0.855	0.964
estExt_gwp_gw1.C_70211 M02220_2.00	Physcomitrella patens	HMATNANDNN	NNHNTNATKD	PBM Weirauch et al.(2014) pTH8489	0.827	0.786
ATHB-5 M06932_2.00	Arabidopsis thaliana	NYAATMATTND	HNAATKATTRN	Dap-seq OMalley et al.(2016) ATHB5_col_a	0.815	0.804
ATHB-5 M06933_2.00	Arabidopsis thaliana	NYAATMATTN	NAATKATTRN	Dap-seq OMalley et al.(2016) ATHB5_colamp_a	0.815	0.804
ATHB-5 M02684_2.00	Arabidopsis thaliana	CAATVATTGVVSV	BSBBCAATBATTG	SELEX Mathelier et al.(2014) MA0110.2	0.815	0.804
ATHB-5 M10630_2.00	Arabidopsis thaliana	CAATVATTG	CAATBATTG	Transfac Matys et al.(2006) P$ATHB5_01	0.815	0.804
ATHB-6 M02040_2.00	Arabidopsis thaliana	HATNATTDN	NHAATNATD	PBM Weirauch et al.(2014) pTH7670	0.801	0.786
ATHB-16 M02050_2.00	Arabidopsis thaliana	YAATMATT	AATKATTR	PBM Weirauch et al.(2014) pTH7270	0.801	0.786
ATHB-6 M06909_2.00	Arabidopsis thaliana	NNNHATKATTR	YAATMATDNNN	Dap-seq OMalley et al.(2016) ATHB6_col_a	0.801	0.786
ATHB-6 M06910_2.00	Arabidopsis thaliana	NCAATAATTRN	NYAATTATTGN	Dap-seq OMalley et al.(2016) ATHB6_colamp_a	0.801	0.786
HAT5 M06914_2.00	Arabidopsis thaliana	NHAATAATTDW	WHAATTATTDN	Dap-seq OMalley et al.(2016) HAT5_col_a	0.796	0.786
HAT5 M06915_2.00	Arabidopsis thaliana	WNYAATAATTRWDN	NHWYAATTATTRNW	Dap-seq OMalley et al.(2016) HAT5_colamp_a	0.796	0.786
HAT5 M02683_2.00	Arabidopsis thaliana	SCAATAATTNNV	BNNAATTATTGS	SELEX Mathelier et al.(2014) MA0008.2	0.796	0.786
HAT5 M10624_2.00	Arabidopsis thaliana	YSCAATAATTNNVN	NBNNAATTATTGSR	Transfac Matys et al.(2006) P$ATHB1_01	0.796	0.786
ATHB-21 M06907_2.00	Arabidopsis thaliana	NNWHCAATWATTDN	NHAATWATTGDWNN	Dap-seq OMalley et al.(2016) ATHB21_col_a	0.737	0.625
ATHB-21 M06908_2.00	Arabidopsis thaliana	WWDDNNNHAATWATTGDTNN	NNAHCAATWATTDNNNHHWW	Dap-seq OMalley et al.(2016) ATHB21_colamp_a	0.737	0.625
HB-5 M06924_2.00	Arabidopsis thaliana	NNAHCAATWATTKDNNNHWWH	DWWDNNNHMAATWATTGDTNN	Dap-seq OMalley et al.(2016) ATHB40_col_a	0.736	0.607
HB-5 M06925_2.00	Arabidopsis thaliana	HHAATWATTGDWNN	NNWHCAATWATTDD	Dap-seq OMalley et al.(2016) ATHB40_colamp_a	0.736	0.607
ATHB-53 M06934_2.00	Arabidopsis thaliana	HMAATAATTRD	HYAATTATTKD	Dap-seq OMalley et al.(2016) ATHB53_col_a	0.731	0.571
ATHB-53 M06935_2.00	Arabidopsis thaliana	NNWHCAATWATTDDN	NHHAATWATTGDWNN	Dap-seq OMalley et al.(2016) ATHB53_colamp_a	0.731	0.571
PK20392.1 M01250_2.00	Cannabis sativa	NHAATMATDN	NHATKATTDN	PBM Lambert et al.(2019) pTH11331	0.708	0.875
PK20392.1 M01251_2.00	Cannabis sativa	NHAATMATDN	NHATKATTDN	PBM Lambert et al.(2019) pTH11332	0.708	0.875
ATHB-20 M06912_2.00	Arabidopsis thaliana	HYAATAATTRD	HYAATTATTRD	Dap-seq OMalley et al.(2016) ATHB20_col_a	0.692	0.839
ATHB-20 M06913_2.00	Arabidopsis thaliana	HYAATMATTRD	HYAATKATTRD	Dap-seq OMalley et al.(2016) ATHB20_colamp_a	0.692	0.839
ATHB-7 M02043_2.00	Arabidopsis thaliana	NHWTGATTGN	NCAATCAWDN	PBM Weirauch et al.(2014) pTH8090	0.601	0.625
ATHB-7 M06911_2.00	Arabidopsis thaliana	NHYCAATCATTSW	WSAATGATTGRDN	Dap-seq OMalley et al.(2016) ATHB7_col_a	0.601	0.625
For this family, TFs with SR scores > 0.599* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Bra003980.1-P	Homeodomain	69	124	EKKRRLNMEQVKTLEKTFELGNKLEPERKMQLARVLGLQPRQIAIWFQNRRARWKT

Links
Other Homeodomain family TFs
Other *Brassica rapa* TFs

819 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action
F443_07993	Phytophthora parasitica	F443_07993	N	0.000
fgenesh_scip_prom.28083.11830	Phytophthora lateralis	fgenesh_scip_prom.28083.11830	N	0.000
fgenesh_scip_prom.46568.2763	Phytophthora kernoviae	fgenesh_scip_prom.46568.2763	N	0.000
HpaG809699	Hyaloperonospora arabidopsidis	HpaG809699	N	0.000
maker-piw_contig_63-fgenesh-gene-0.1	Pythium iwayamai	maker-piw_contig_63-fgenesh-gene-0.1	N	0.000
Phyra93231	Phytophthora ramorum	Phyra93231	N	0.000
Physo130061	Phytophthora sojae	Physo130061	N	0.000
snap_masked-par_contig_517-abinit-gene-0.15	Pythium arrhenomanes	snap_masked-par_contig_517-abinit-gene-0.15	N	0.000

Bra003980 (Brassica rapa) Homeodomain

TF Information

Directly determined binding motifs

Motifs from related TFs

DNA Binding Domains

Links

819 Related TFs

Bra003980 **(Brassica rapa)
Homeodomain**