CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

GI11292 *(Drosophila mojavensis)* Homeodomain
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00046 (Homeobox)	IPR001356	FBgn0134053	T217842_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
H2.0 M06489_2.00	Drosophila melanogaster	WTWATDA	THATWAW	B1H Mathelier et al.(2014) MA0448.1	0.867	0.982
H2.0 M06250_2.00	Drosophila melanogaster	TWWWWDA	THAWWWA	B1H Zhu et al.(2011) H2.0_Cell_FBgn0001170	0.867	0.982
H2.0 M06251_2.00	Drosophila melanogaster	WTWATTRN	NYAATWAW	B1H Zhu et al.(2011) H2.0_SOLEXA_FBgn0001170	0.867	0.982
Hlx M00485_2.00	Mus musculus	NNNAWND	HNWTNNN	PBM Berger et al.(2008) Hlx1_2350	0.847	0.825
Dbx M02128_2.00	Drosophila melanogaster	WTTAATTA	TAATTAAW	PBM Weirauch et al.(2014) pTH6051	0.749	0.719
Dbx M06550_2.00	Drosophila melanogaster	TTWATKA	TMATWAA	B1H Mathelier et al.(2014) MA0174.1	0.749	0.719
Dbx1 M00451_2.00	Mus musculus	WTTAATTA	TAATTAAW	PBM Berger et al.(2008) Dbx1_3486	0.732	0.667
Dbx2 M00499_2.00	Mus musculus	NNDTNNN	NNNAHNN	PBM Berger et al.(2008) Dbx2_3487	0.712	0.649
For this family, TFs with SR scores > 0.599* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
FBpp0160509	Homeodomain	301	357	SWSRAVFTNLQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVWFQNRRMKWRH

Links
Other Homeodomain family TFs
Other *Drosophila mojavensis* TFs