CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

cassava24236.valid.m1 *(Manihot esculenta)* Homeodomain
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00046 (Homeobox)	IPR001356	cassava24236.valid.m1	T227070_2.00	JGI (2012-Mar-17)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
ATH1 M10627_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$ATH1_01	0.840	0.809
Q5EVH4_OIKDI M02227_2.00	Oikopleura dioica	NTGACAKN	NMTGTCAN	PBM Weirauch et al.(2014) pTH6041	0.626	0.574
MEIS3 M03093_2.00	Homo sapiens	DTGACANN	NNTGTCAH	SELEX Jolma et al.(2013) MEIS3_1	0.606	0.447
MEIS3 M03094_2.00	Homo sapiens	TGACAGSTGTCA	TGACASCTGTCA	SELEX Jolma et al.(2013) MEIS3_2	0.606	0.447
MEIS3 M04951_2.00	Homo sapiens	TGWCABVTGWCA	TGWCABVTGWCA	SELEX Yin et al.(2017) MEIS3_eDBD_HT-SELEX	0.606	0.447
MEIS3 M04952_2.00	Homo sapiens	YGWCABVTGWCR	YGWCABVTGWCR	SELEX Yin et al.(2017) MEIS3_eDBD_Methyl-HT-SELEX	0.606	0.447
For this family, TFs with SR scores > 0.599* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
cassava24236.valid.m1	Homeodomain	363	412	SVSVLRAWLFEHFLHPYPKDSDKHMLAKQTGLTRSQVSNWFINARVRLWK

Links
Other Homeodomain family TFs
Other *Manihot esculenta* TFs