CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

Gorai.004G206600 *(Gossypium raimondii)* Homeodomain
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00046 (Homeobox)	IPR001356	Gorai.004G206600	T228706_2.00	JGI:Phytozome (2018-Apr-12)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
PK25034.1 M01254_2.00	Cannabis sativa	NNTGACRKBN	NVMYGTCANN	PBM Lambert et al.(2019) pTH11259	0.731	0.673
KNAT4 M01238_2.00	Arabidopsis thaliana	NNGACNNNN	NNNNGTCNN	PBM Lambert et al.(2019) pTH9968	0.714	0.827
KNAT3 M02051_2.00	Arabidopsis thaliana	NNNGACVBNN	NNVBGTCNNN	PBM Weirauch et al.(2014) pTH7600	0.714	0.827
KNAT7 M01064_2.00	Arabidopsis thaliana	TGACRKST	ASMYGTCA	PBM Sullivan et al.(2014) pTH9798	0.711	0.904
HOS66 M02156_2.00	Oryza sativa	NNNNDHNN	NNDHNNNN	PBM Weirauch et al.(2014) pTH8332	0.706	0.942
GRMZM2G087741 M02138_2.00	Zea mays	NNTGACRKCN	NGMYGTCANN	PBM Weirauch et al.(2014) pTH5816	0.636	0.692
For this family, TFs with SR scores > 0.599* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Gorai.004G206600.1	Homeodomain	230	284	GKLPGDTTTVLKNWWQQHSKWPYPTEDDKAKLVEETGLQLKQINNWFINQRKRNW

Links
Other Homeodomain family TFs
Other *Gossypium raimondii* TFs