CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

Pavir.Bb00225 *(Panicum virgatum)* Homeodomain
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00046 (Homeobox)	IPR001356	Pavir.Bb00225	T229217_2.00	JGI:Phytozome (2018-Apr-12)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
KNAT6 M02037_2.00	Arabidopsis thaliana	NNWGACNNNN	NNNNGTCWNN	PBM Weirauch et al.(2014) pTH7296	0.850	0.842
KNOX3_HORVU M10790_2.00	Hordeum vulgare	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$KNOX3_01	0.846	0.895
GRMZM2G135447 M02139_2.00	Zea mays	DTGACRKS	SMYGTCAH	PBM Weirauch et al.(2014) pTH6328	0.803	0.930
GRMZM2G087741 M02138_2.00	Zea mays	NNTGACRKCN	NGMYGTCANN	PBM Weirauch et al.(2014) pTH5816	0.764	0.719
PK25034.1 M01254_2.00	Cannabis sativa	NNTGACRKBN	NVMYGTCANN	PBM Lambert et al.(2019) pTH11259	0.710	0.877
For this family, TFs with SR scores > 0.599* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Pavir.Bb00225.1.p	Homeodomain	249	308	KKKKGKLPKEARQKLLHWWELHYKWPYPSETEKIALAESTGLDQKQINNWFINQRKRHWK

Links
Other Homeodomain family TFs
Other *Panicum virgatum* TFs