TF Information

mgf025532m *(Mimulus guttatus)* MADS box
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00319 (SRF-TF)	IPR002100	mgf025532m	T257469_2.00	JGI (2012-Mar-17)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
AGL6 M06986_2.00	Arabidopsis thaliana	TTWCCHAAAAWRGWAANWW	WWNTTWCYWTTTTDGGWAA	Dap-seq OMalley et al.(2016) AGL6_col_a	0.708	0.708
A1YJE4_HORVD M10900_2.00	Hordeum vulgare	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$BM10_01	0.708	0.708
MAD17_ORYSJ M10961_2.00	Oryza sativa	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$MADS17_01	0.708	0.708
MADS6 M10967_2.00	Oryza sativa	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$MADS6_01	0.708	0.708
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
mgf025532m	MADS box	10	57	RIEDNGARMVCFSKRRNGLIKKAKELSVLCDVDVAAIIFSKRGKLFQF

Links
Other MADS box family TFs
Other *Mimulus guttatus* TFs

Invalid Input OrderBy

160 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action