CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

ENSP00000395535 *(Macaca fascicularis)* MBD
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF01429 (MBD)	IPR001739	ENSP00000395535	T261274_2.00	GigaDB (2015-Oct-22)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
Mecp2 M00806_2.00	Mus musculus	NNNNNHAHNN	NNDTDNNNNN	PBM Weirauch et al.(2013) pTH3054	1.000	1.000
MECP2 M09257_2.00	Homo sapiens	SCCGGRR	YYCCGGS	Misc Kulakovskiy et al.(2013) MECP2_HUMAN.H11MO.0.C	1.000	1.000
Mecp2 M09259_2.00	Mus musculus	SCCGGRR	YYCCGGS	Misc Kulakovskiy et al.(2013) MECP2_MOUSE.H11MO.0.C	1.000	1.000
MECP2 M11032_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$MECP2_01	1.000	1.000
MECP2 M11033_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$MECP2_02	1.000	1.000
MECP2 M11034_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$MECP2_Q4_01	1.000	1.000
MECP2 M11035_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$MECP2_Q4	1.000	1.000
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
ENSP00000395535	MBD	82	153	RGPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIAYFEKVGDTSLDPNDFDFTVTGR

Links
Other MBD family TFs
Other *Macaca fascicularis* TFs