CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

TCM_012262 *(Theobroma cacao)* Myb/SANT
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00249 (Myb_DNA-binding)	IPR014778	TCM_012262	T280484_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
AT1G49010 M01269_2.00	Arabidopsis thaliana	NNYWATCNN	NNGATWRNN	PBM Lambert et al.(2019) pTH11535	0.764	0.848
AT1G49010 M07022_2.00	Arabidopsis thaliana	NHHWWYCTTATCYWH	DWRGATAAGRWWDDN	Dap-seq OMalley et al.(2016) At1g49010_col_a	0.764	0.848
AT1G49010 M07023_2.00	Arabidopsis thaliana	WWYCTTATCYWHWHH	DDWDWRGATAAGRWW	Dap-seq OMalley et al.(2016) At1g49010_colamp_a	0.764	0.848
PK19621.1 M01280_2.00	Cannabis sativa	NNTTATCYN	NRGATAANN	PBM Lambert et al.(2019) pTH10140	0.726	0.837
For this family, TFs with SR scores > 0.661* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
EOY20939	Myb	135	180	PWTEEEHRLFLLGLDKFGKGDWRSISRNFVISRTPTQVASHAQKYF

Links
Other Myb/SANT family TFs
Other *Theobroma cacao* TFs