CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

Carubv10003097m.g *(Capsella rubella)* Myb/SANT
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00249 (Myb_DNA-binding)	IPR014778	Carubv10003097m.g	T286231_2.00	JGI:Phytozome (2018-Apr-12)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
AT1G14600 M01268_2.00	Arabidopsis thaliana	NWAYATTCYN	NRGAATRTWN	PBM Lambert et al.(2019) pTH11557	0.755	0.766
PHL1 M02310_2.00	Arabidopsis thaliana	NWKATNCBNN	NNVGNATMWN	PBM Weirauch et al.(2014) pTH7122	0.669	0.681
PHL1 M07132_2.00	Arabidopsis thaliana	MDRGAATATTCBNWN	NWNVGAATATTCYHK	Dap-seq OMalley et al.(2016) At5g29000_col_a	0.669	0.681
PHR1 M02329_2.00	Oryza sativa	NWKATNCBNN	NNVGNATMWN	PBM Weirauch et al.(2014) pTH7755	0.667	0.702
For this family, TFs with SR scores > 0.661* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Carubv10003097m	Myb	16	67	RLRWNSDLHNSFVQAVEQLGGENRATPKMVLQLMDVKGLTISHVKSHLQMYR

Links
Other Myb/SANT family TFs
Other *Capsella rubella* TFs