CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

KLTH0B05016g *(Kluyveromyces thermotolerans)* Myb/SANT
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00249 (Myb_DNA-binding)	IPR014778	KLTH0B05016g	T290908_2.00	Superfamily (2010-Oct-26)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
TOD6 M00062_2.00	Saccharomyces cerevisiae	Transfac license required NCATCNNN	Transfac license required NNNGATGN	PBM Badis et al.(2008) YBL054W_2048	0.776	0.826
DOT6 M00064_2.00	Saccharomyces cerevisiae	Transfac license required SKCATCGV	Transfac license required BCGATGMS	PBM Badis et al.(2008) DOT6_2080	0.692	0.891
DOT6 M01560_2.00	Saccharomyces cerevisiae	Transfac license required VBCATCDN	Transfac license required NHGATGVB	PBM Zhu et al.(2009) Pbf2	0.692	0.891
DOT6 M08595_2.00	Saccharomyces cerevisiae	Transfac license required NNNNDNWSCTCATCGVNHNNN	Transfac license required NNNDNBCGATGAGSWNHNNNN	Misc DeBoer et al.(2011) YER088C_812	0.692	0.891
For this family, TFs with SR scores > 0.661* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
KLTH0B05016g	Myb	24	69	PSSWDPQDDVLLRHLKEIKKLGWKDIAQYFKNRTPNACQFRWRRLK

Links
Other Myb/SANT family TFs
Other *Kluyveromyces thermotolerans* TFs