CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

RPRC003790 *(Rhodnius prolixus)* Rel
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00554 (RHD_DNA_bind)	IPR011539	RPRC003790	T317692_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
dl M02712_2.00	Drosophila melanogaster	SGGGKTTTTYCV	BGRAAAAMCCCS	SELEX Mathelier et al.(2014) MA0022.1	0.779	0.779
dl M02713_2.00	Drosophila melanogaster	GGGGWWTTCC	GGAAWWCCCC	SELEX Mathelier et al.(2014) MA0023.1	0.779	0.779
dl M09691_2.00	Drosophila melanogaster	BRGRWTTYCCM	KGGRAAWYCYV	Misc Kulakovskiy et al.(2009) dl	0.779	0.779
dl M11243_2.00	Drosophila melanogaster	GGGTTTTTCCV	BGGAAAAACCC	Transfac Matys et al.(2006) I$DL_01	0.779	0.779
dl M11244_2.00	Drosophila melanogaster	BRDTTTTCYSD	HSRGAAAAHYV	Transfac Matys et al.(2006) I$DL_02	0.779	0.779
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
RPRC003790-PA	Rel	5	137	FYLQIVGYRGRAVVVVSCVTKDSPYRPHPHNLVGKEGCKKGVCTVEINNETMTAAFANLGIQCVKKKDIEEALRVREEIRVDPFRTGFSHKTQTSGIDLNSVRLCFQAFLEGPQRGKFTNPLSPIVSEPIYDK

Links
Other Rel family TFs
Other *Rhodnius prolixus* TFs