CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

GSMUA_Achr4G23650_001 *(Musa acuminata)* SBP
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF03110 (SBP)	IPR004333	GSMUA_Achr4G23650_001	T322655_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
PK22320.1 M02483_2.00	Cannabis sativa	NNGTACGGNN	NNCCGTACNN	PBM Weirauch et al.(2014) pTH9723	0.898	0.800
SPL5 M02474_2.00	Arabidopsis thaliana	NNGTACGDN	NHCGTACNN	PBM Weirauch et al.(2014) pTH7385	0.888	0.720
SPL5 M07261_2.00	Arabidopsis thaliana	NDNYGTACGGAH	DTCCGTACRNHN	Dap-seq OMalley et al.(2016) SPL5_col_a	0.888	0.720
SPL5 M07262_2.00	Arabidopsis thaliana	NBGTACGGWH	DWCCGTACVN	Dap-seq OMalley et al.(2016) SPL5_colamp_a	0.888	0.720
For this family, TFs with SR scores > 0.885* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
GSMUA_Achr4P23650_001	SBP	76	150	CQAEKCAADLAEAKRYHRRHRVCEAHSKAAVVIVAGLRQRFCQQCSRFHEVSEFDDSKRSCRRRLAGHNERRRKS

Links
Other SBP family TFs
Other *Musa acuminata* TFs