CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

Carubv10021641m.g *(Capsella rubella)* Sox
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00505 (HMG_box)	IPR000910	Carubv10021641m.g	T334425_2.00	JGI:Phytozome (2018-Apr-12)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
CRC M07266_2.00	Arabidopsis thaliana	TWATCATW	WATGATWA	Dap-seq OMalley et al.(2016) CRC_col_a	0.741	1.000
CRC M07267_2.00	Arabidopsis thaliana	GGTTAGTGTTTTGGAGTCGAATATGACTTG	CAAGTCATATTCGACTCCAAAACACTAACC	Dap-seq OMalley et al.(2016) CRC_colamp_a	0.741	1.000
YAB1 M00890_2.00	Arabidopsis thaliana	AATAATWA	TWATTATT	PBM Franco-Zorrilla et al.(2014) YAB1	0.660	0.689
YAB5 M02486_2.00	Arabidopsis thaliana	NNNNHRN	NYDNNNN	PBM Weirauch et al.(2014) pTH7575	0.630	0.644
YAB5 M00889_2.00	Arabidopsis thaliana	NATRATTADNNN	NNNHTAATYATN	PBM Franco-Zorrilla et al.(2014) YAB5	0.630	0.644
INO M02485_2.00	Arabidopsis thaliana	NHNNNYRNNN	NNNYRNNNDN	PBM Weirauch et al.(2014) pTH7516	0.560	0.578
For this family, TFs with SR scores > 0.415* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Carubv10021641m	Sox	114	158	KQRLPSAYNRFMRDEIQRIKSANPEIPHREAFSAAAKNWAKYIPN

Links
Other Sox family TFs
Other *Capsella rubella* TFs