CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

SPAPADRAFT_130733 *(Spathaspora passalidarum)* STE
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF02200 (STE)	IPR003120	SPAPADRAFT_130733	T338122_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
STE12 M00071_2.00	Saccharomyces cerevisiae	NTGTTTCANN	NNTGAAACAN	PBM Badis et al.(2008) STE12_4502	0.755	0.755
STE12 M00916_2.00	Saccharomyces cerevisiae	NYGTTTCAKN	NMTGAAACRN	PBM Gordan et al.(2011) Ste12	0.755	0.755
STE12 M08608_2.00	Saccharomyces cerevisiae	TGTTTCA	TGAAACA	Misc DeBoer et al.(2011) YHR084W_400	0.755	0.755
STE12 M11373_2.00	Saccharomyces cerevisiae	Transfac license required	Transfac license required	Transfac Matys et al.(2006) F$STE12P_Q4	0.755	0.755
STE12 M08463_2.00	Saccharomyces cerevisiae	YGTTTCA	TGAAACR	COMPILED Mathelier et al.(2014) MA0393.1	0.755	0.755
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
EGW35202	STE	42	151	QVIRRYYLNHDEGFVSCVFWNNLYFITGTDIVRCIVYKFEHFGRKIVDRKKFEEGIFSDLRNLKCGTDAILEPPRSEFLEFLFKNSCLRTQKKQKVFFWFNVPHDKLMAD

Links
Other STE family TFs
Other *Spathaspora passalidarum* TFs