CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

OBART02G32460 *(Oryza barthii)* TCP
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF03634 (TCP)	IPR005333	OBART02G32460	T344067_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
LjT20A21.20.nc M02519_2.00	Lotus japonicus	GGGACCAY	RTGGTCCC	PBM Weirauch et al.(2014) pTH9202	0.876	0.520
PK10344.1 M01313_2.00	Cannabis sativa	GGGACCAC	GTGGTCCC	PBM Lambert et al.(2019) pTH11464	0.868	0.507
TCP2 M02503_2.00	Arabidopsis thaliana	NBGGKMCCVN	NBGGKMCCVN	PBM Weirauch et al.(2014) pTH8198	0.855	0.467
TCP2 M02508_2.00	Arabidopsis lyrata	GGSMCCAC	GTGGKSCC	PBM Weirauch et al.(2014) pTH9231	0.855	0.467
TCP5 M02510_2.00	Arabidopsis lyrata	GGGACCAC	GTGGTCCC	PBM Weirauch et al.(2014) pTH9233	0.842	0.520
TCP5 M02505_2.00	Arabidopsis thaliana	GGGACCAY	RTGGTCCC	PBM Weirauch et al.(2014) pTH7523	0.835	0.520
For this family, TFs with SR scores > 0.822* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
OBART02G32460.1	TCP	31	123	PGGDKHSKVVTSRGLHDRRIRLSVPTYIAFYDIQDRLGVNRPSKSIEWLICAALVARLLLHPPQRRPAPHPRRPSSGRPSEEQARTRKATVGG

Links
Other TCP family TFs
Other *Oryza barthii* TFs