CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

AT-TCP20 *(Vitis vinifera)* TCP
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF03634 (TCP)	IPR005333	VIT_14s0068g01690	T344497_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
PK13314.1 M01316_2.00	Cannabis sativa	NNGGNCCCAC	GTGGGNCCNN	PBM Lambert et al.(2019) pTH11330	0.977	0.764
GLYMA19G26560 M02511_2.00	Glycine max	BGGBCCCAC	GTGGGVCCV	PBM Weirauch et al.(2014) pTH9184	0.974	0.691
AT-TCP20 M02507_2.00	Arabidopsis lyrata	GRSCCCAC	GTGGGSYC	PBM Weirauch et al.(2014) pTH9229	0.971	0.655
TCP20 M02502_2.00	Arabidopsis thaliana	GGSCCCACNN	NNGTGGGSCC	PBM Weirauch et al.(2014) pTH8159	0.970	0.627
TCP20 M07285_2.00	Arabidopsis thaliana	NNNNNNNNNNGTGGGRCCCAC	GTGGGYCCCACNNNNNNNNNN	Dap-seq OMalley et al.(2016) TCP20_col_a	0.970	0.627
TCP20 M07286_2.00	Arabidopsis thaliana	RTGGGDCCCACH	DGTGGGHCCCAY	Dap-seq OMalley et al.(2016) TCP20_colamp_a	0.970	0.627
TCP20 M11397_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$TCP20_01	0.970	0.627
cassava45561.m1 M02516_2.00	Manihot esculenta	KGGVCCCACH	DGTGGGBCCM	PBM Weirauch et al.(2014) pTH9207	0.968	0.673
TCP15 M00892_2.00	Arabidopsis thaliana	NNGGNCCCAC	GTGGGNCCNN	PBM Franco-Zorrilla et al.(2014) TCP15	0.961	0.636
TCP15 M07277_2.00	Arabidopsis thaliana	RTRGGDCCCACHH	DDGTGGGHCCYAY	Dap-seq OMalley et al.(2016) At1g69690_col_a	0.961	0.636
TCP15 M07278_2.00	Arabidopsis thaliana	RTRGGNCCCACHW	WDGTGGGNCCYAY	Dap-seq OMalley et al.(2016) At1g69690_colamp_a	0.961	0.636
TCP15 M11394_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$TCP15_01	0.961	0.636
PCF2 M11399_2.00	Oryza sativa	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$PCF2_01	0.961	0.555
VIT_15s0048g01150 M02515_2.00	Vitis vinifera	NNGGNCCCAC	GTGGGNCCNN	PBM Weirauch et al.(2014) pTH9294	0.960	0.573
PK14653.1 M01317_2.00	Cannabis sativa	BGGSCCCAC	GTGGGSCCV	PBM Lambert et al.(2019) pTH11324	0.958	0.618
PK14653.1 M02517_2.00	Cannabis sativa	BTGGGCCCAV	BTGGGCCCAV	PBM Weirauch et al.(2014) pTH9586	0.958	0.618
LjSGA_053525.1 M02518_2.00	Lotus japonicus	GGNCCCAC	GTGGGNCC	PBM Weirauch et al.(2014) pTH9201	0.956	0.555
TCP9 M01086_2.00	Arabidopsis thaliana	NNGGGCCCACN	NGTGGGCCCNN	PBM Sullivan et al.(2014) pTH9796	0.956	0.555
TCP9 M07281_2.00	Arabidopsis thaliana	RTGGGDCCCAC	GTGGGHCCCAY	Dap-seq OMalley et al.(2016) At2g45680_colamp_a	0.956	0.555
TCP9 M07282_2.00	Arabidopsis thaliana	DGTGGGRCCCACDDNDNDNBN	NVNHNHNHHGTGGGYCCCACH	Dap-seq OMalley et al.(2016) At2g45680_col_b	0.956	0.555
PK12736.1 M01315_2.00	Cannabis sativa	NRRSCMYAYNNNNN	NNNNNRTRKGSYYN	PBM Lambert et al.(2019) pTH10121	0.954	0.573
TCP14 M07289_2.00	Arabidopsis thaliana	AVADAKVDBGTGGGDCCCAC	GTGGGHCCCACVHBMTHTBT	Dap-seq OMalley et al.(2016) TCP14_col_b	0.953	0.582
TCP8 M01311_2.00	Arabidopsis thaliana	NGGNMCCAC	GTGGKNCCN	PBM Lambert et al.(2019) pTH11569	0.950	0.591
TCP19 M02504_2.00	Arabidopsis thaliana	NNGGVCCCAC	GTGGGBCCNN	PBM Weirauch et al.(2014) pTH7452	0.949	0.518
fgenesh2_kg.8__1074__AT5G51910.2 M02509_2.00	Arabidopsis lyrata	GRSCCCAC	GTGGGSYC	PBM Weirauch et al.(2014) pTH9232	0.946	0.518
TCP7 M07294_2.00	Arabidopsis thaliana	RTGGGNCCCAC	GTGGGNCCCAY	Dap-seq OMalley et al.(2016) TCP7_col_a	0.945	0.591
TCP22 M07279_2.00	Arabidopsis thaliana	RTRGGNCCCACHN	NDGTGGGNCCYAY	Dap-seq OMalley et al.(2016) At1g72010_colamp_a	0.943	0.545
TCP22 M07280_2.00	Arabidopsis thaliana	RTGGGDCCCACNN	NNGTGGGHCCCAY	Dap-seq OMalley et al.(2016) At1g72010_col	0.943	0.545
TCP23 M00891_2.00	Arabidopsis thaliana	NNGGKCCCAC	GTGGGMCCNN	PBM Franco-Zorrilla et al.(2014) TCP23	0.939	0.527
TCP21 M07292_2.00	Arabidopsis thaliana	NNRTGGGDCCCACN	NGTGGGHCCCAYNN	Dap-seq OMalley et al.(2016) At5g08330_col_a	0.936	0.564
TCP21 M07293_2.00	Arabidopsis thaliana	RTRGGDCCCACH	DGTGGGHCCYAY	Dap-seq OMalley et al.(2016) At5g08330_colamp_a	0.936	0.564
OsI_08196 M02513_2.00	Oryza sativa	GGGCCCAC	GTGGGCCC	PBM Weirauch et al.(2014) pTH9274	0.930	0.491
OS02G0635800 M02512_2.00	Oryza sativa	NBGGGCCCVN	NBGGGCCCVN	PBM Weirauch et al.(2014) pTH8856	0.929	0.500
TCP11 M11395_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$TCP11_01	0.890	0.518
TCP11 M11396_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$TCP11_02	0.890	0.518
For this family, TFs with SR scores > 0.822* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
VIT_14s0068g01690.t01	TCP	53	295	SSNKDRHTKVEGRGRRIRMPALCAARIFQLTRELGHKSDGETIQWLLQQAEPSIIAATGTGTIPASALAAAGGSVSQQGTSISAGLHQKIDELGGSSIGSGSSRTSWAMVGANLGRPHVATGLWPPVSGFGFQSSSGPSTTNLGNESSNYLQKIAFPGFDLPATNLGPMSFTSILGGSNQQLPGLELGLSQDGHIGVLNSQALSQIYQQMGQARVHQQQQHQHQHQHQHQQQPPAKDDSQGSG

Links
Other TCP family TFs
Other *Vitis vinifera* TFs

655 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action
ACOM041255	Anopheles coluzzii	ACOM041255	N
ACUA018995	Anopheles culicifacies	ACUA018995	N
ADAC009336	Anopheles darlingi	ADAC009336	N
AFAF018730	Anopheles farauti	AFAF018730	N
AFUN003257	Anopheles funestus	AFUN003257	N
AGAP011589	Anopheles gambiae	AGAP011589	N
AMEC002597	Anopheles melas	AMEC002597	N
AMEM006925	Anopheles merus	AMEM006925	N
AMIN008850	Anopheles minimus	AMIN008850	N
ASTEI03911	Anopheles stephensi	ASTEI03911	N

AT-TCP20 (Vitis vinifera) TCP

TF Information

Directly determined binding motifs

Motifs from related TFs

DNA Binding Domains

Links

655 Related TFs

AT-TCP20 **(Vitis vinifera)
TCP**