CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

Cucsa.113300 *(Cucumis sativus)* TCP
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF03634 (TCP)	IPR005333	Cucsa.113300	T344635_2.00	JGI (2012-Mar-17)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
PK10344.1 M01313_2.00	Cannabis sativa	GGGACCAC	GTGGTCCC	PBM Lambert et al.(2019) pTH11464	0.923	0.536
TCP5 M02510_2.00	Arabidopsis lyrata	GGGACCAC	GTGGTCCC	PBM Weirauch et al.(2014) pTH9233	0.918	0.577
TCP5 M02505_2.00	Arabidopsis thaliana	GGGACCAY	RTGGTCCC	PBM Weirauch et al.(2014) pTH7523	0.915	0.608
TCP17 M07290_2.00	Arabidopsis thaliana	GTGGGGACCAC	GTGGTCCCCAC	Dap-seq OMalley et al.(2016) TCP17_col_a	0.896	0.536
TCP17 M07291_2.00	Arabidopsis thaliana	RTGGGGACCAC	GTGGTCCCCAY	Dap-seq OMalley et al.(2016) TCP17_colamp_a	0.896	0.536
LjT20A21.20.nc M02519_2.00	Lotus japonicus	GGGACCAY	RTGGTCCC	PBM Weirauch et al.(2014) pTH9202	0.874	0.443
TCP13 M07283_2.00	Arabidopsis thaliana	GTGGGGACCACWD	HWGTGGTCCCCAC	Dap-seq OMalley et al.(2016) PTF1_col_a	0.872	0.526
TCP13 M07284_2.00	Arabidopsis thaliana	NNBGGGACCACHN	NDGTGGTCCCVNN	Dap-seq OMalley et al.(2016) PTF1_colamp_a	0.872	0.526
TCP4 M02514_2.00	Arabidopsis lyrata	BKGGGACCAC	GTGGTCCCMV	PBM Weirauch et al.(2014) pTH9313	0.855	0.433
TCP4 M02501_2.00	Arabidopsis thaliana	GGGACCAC	GTGGTCCC	PBM Weirauch et al.(2014) pTH8084	0.851	0.433
TCP3 M02500_2.00	Arabidopsis thaliana	NDGGMCCACN	NGTGGKCCHN	PBM Weirauch et al.(2014) pTH8835	0.850	0.443
TCP3 M07274_2.00	Arabidopsis thaliana	DHNGGGACCACH	DGTGGTCCCNDH	Dap-seq OMalley et al.(2016) TCP3_colamp_a	0.850	0.443
TCP3 M07275_2.00	Arabidopsis thaliana	DNBGGGACCACHN	NDGTGGTCCCVNH	Dap-seq OMalley et al.(2016) TCP3_col	0.850	0.443
TCP2 M02503_2.00	Arabidopsis thaliana	NBGGKMCCVN	NBGGKMCCVN	PBM Weirauch et al.(2014) pTH8198	0.837	0.423
TCP2 M02508_2.00	Arabidopsis lyrata	GGSMCCAC	GTGGKSCC	PBM Weirauch et al.(2014) pTH9231	0.837	0.412
OS01G0213800 M11398_2.00	Oryza sativa	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$PCF5_01	0.835	0.443
For this family, TFs with SR scores > 0.822* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Cucsa.113300.1	TCP	27	123	FGGKDRHSKVCTIKGLRDRRIRLSIPTAIQLYDLQNKLGLSQPSKVIDWLIDVTRFEIDKLPPLPFPKDFDPNASILHHSDIGDAAFKAKNEETDHT

Links
Other TCP family TFs
Other *Cucumis sativus* TFs

375 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action
GRMZM2G426154	Zea mays	GRMZM2G426154	N
Pavir.J17924	Panicum virgatum	Pavir.J17924	N
Pavir.J24898	Panicum virgatum	Pavir.J24898	N
Pavir.J31727	Panicum virgatum	Pavir.J31727	N

Cucsa.113300 (Cucumis sativus) TCP

TF Information

Directly determined binding motifs

Motifs from related TFs

DNA Binding Domains

Links

375 Related TFs

Cucsa.113300 **(Cucumis sativus)
TCP**