CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

Eucgr.G00619 *(Eucalyptus grandis)* WRKY
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF03106 (WRKY)	IPR003657	Eucgr.G00619	T356104_2.00	JGI:Phytozome (2018-Apr-12)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
WRKY6 M07377_2.00	Arabidopsis thaliana	DNNNHNDHNHNRGTCAACG	CGTTGACYNDNDHNDNNNH	Dap-seq OMalley et al.(2016) WRKY6_col_a	0.875	0.898
WRKY6 M07378_2.00	Arabidopsis thaliana	NNHNWRGTCAACKNH	DNMGTTGACYWNDNN	Dap-seq OMalley et al.(2016) WRKY6_colamp_a	0.875	0.898
WRKY31 M07408_2.00	Arabidopsis thaliana	NNNNHNNNNNDRGTCAACG	CGTTGACYHNNNNNDNNNN	Dap-seq OMalley et al.(2016) WRKY31_col_a	0.873	0.898
WRKY31 M07409_2.00	Arabidopsis thaliana	NHWRGTCAACKNH	DNMGTTGACYWDN	Dap-seq OMalley et al.(2016) WRKY31_colamp_a	0.873	0.898
WRKY42 M07404_2.00	Arabidopsis thaliana	NDWRGTCAACDNNNNDNNHNN	NNDNNHNNNNHGTTGACYWHN	Dap-seq OMalley et al.(2016) WRKY42_col_a	0.871	0.881
WRKY42 M07405_2.00	Arabidopsis thaliana	HNDNNNWRGTCAACKNHNDD	HHNDNMGTTGACYWNNNHND	Dap-seq OMalley et al.(2016) WRKY42_colamp_a	0.871	0.881
WRKY47 M00732_2.00	Arabidopsis thaliana	NNRGTCAACKN	NMGTTGACYNN	PBM Chang et al.(2013) pTH7913	0.869	0.847
WRKY47 M07402_2.00	Arabidopsis thaliana	WRGTCAAMGNHVDK	MHBDNCKTTGACYW	Dap-seq OMalley et al.(2016) WRKY47_col_a	0.869	0.847
WRKY47 M07403_2.00	Arabidopsis thaliana	NNNHWRGTCAACKNHNNNN	NNNNDNMGTTGACYWDNNN	Dap-seq OMalley et al.(2016) WRKY47_colamp_a	0.869	0.847
WRKY60 M02551_2.00	Arabidopsis thaliana	NYGGTCAAMNN	NNKTTGACCRN	PBM Weirauch et al.(2014) pTH7379	0.820	0.644
WRKY40 M02548_2.00	Arabidopsis thaliana	NRGTCAWN	NWTGACYN	PBM Weirauch et al.(2014) pTH8398	0.819	0.627
WRKY40 M07379_2.00	Arabidopsis thaliana	NNNAAAGTCAAVR	YBTTGACTTTNNN	Dap-seq OMalley et al.(2016) WRKY40_colamp_a	0.819	0.627
WRKY40 M07380_2.00	Arabidopsis thaliana	NNVAAAGTCAAVRNH	DNYBTTGACTTTBNN	Dap-seq OMalley et al.(2016) WRKY40_col	0.819	0.627
WRKY40 M08180_2.00	Arabidopsis thaliana	NNAGTCAANN	NNTTGACTNN	ChIP-seq Mathelier et al.(2014) MA1085.2	0.819	0.627
WRKY18 M02560_2.00	Arabidopsis thaliana	NNRGTCAANN	NNTTGACYNN	PBM Weirauch et al.(2014) pTH7360	0.816	0.661
WRKY18 M00900_2.00	Arabidopsis thaliana	NVGTCNN	NNGACBN	PBM Franco-Zorrilla et al.(2014) WRKY18	0.816	0.661
WRKY18 M07416_2.00	Arabidopsis thaliana	NNHRGTCAASR	YSTTGACYDNN	Dap-seq OMalley et al.(2016) WRKY18_col_a	0.816	0.661
WRKY18 M07417_2.00	Arabidopsis thaliana	NNNHWAGTCAANR	YNTTGACTWDNNN	Dap-seq OMalley et al.(2016) WRKY18_colamp_a	0.816	0.661
WRKY18 M11465_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$WRKY18_Q2	0.816	0.661
For this family, TFs with SR scores > 0.808* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Eucgr.G00619.1	WRKY	168	226	SDGCQWRKYGQKIAKGNPCPRAYYRCTVAPGCPVRKQVQRCLEDMSILITTYEGTHNHP

Links
Other WRKY family TFs
Other *Eucalyptus grandis* TFs

780 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action
A1O3_09824	Capronia epimyces	A1O3_09824	N
A1O7_00807	Cladophialophora yegresii	A1O7_00807	N
BBA_03449	Beauveria bassiana	BBA_03449	N
Cob_02109	Colletotrichum orbiculare	Cob_02109	N
DOTSEDRAFT_164590	Dothistroma septosporum	DOTSEDRAFT_164590	N
EPUS_06872	Endocarpon pusillum	EPUS_06872	N
HMPREF1120_00436	Exophiala dermatitidis	HMPREF1120_00436	N
HMPREF1541_10856	Cyphellophora europaea	HMPREF1541_10856	N
PV09_00114	Verruconis gallopava	PV09_00114	N
PV11_06917	Exophiala sideris	PV11_06917	N
S40285_06624	Stachybotrys chlorohalonata	S40285_06624	N
S40288_05176	Stachybotrys chartarum	S40288_05176	N

Eucgr.G00619 (Eucalyptus grandis) WRKY

TF Information

Directly determined binding motifs

Motifs from related TFs

DNA Binding Domains

Links

780 Related TFs

Eucgr.G00619 **(Eucalyptus grandis)
WRKY**