CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

LjSGA_025444.2 *(Lotus japonicus)* WRKY
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF03106 (WRKY)	IPR003657	LjSGA_025444.2	T357147_2.00	Superfamily (2010-Oct-26)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
WRKY27 M02566_2.00	Arabidopsis thaliana	NNGTCHDNN	NNHDGACNN	PBM Weirauch et al.(2014) pTH8188	0.835	0.644
WRKY27 M07430_2.00	Arabidopsis thaliana	MAAAGTCAACKNH	DNMGTTGACTTTK	Dap-seq OMalley et al.(2016) WRKY27_col_a	0.835	0.644
WRKY27 M07431_2.00	Arabidopsis thaliana	HAAAGTCAACKNH	DNMGTTGACTTTD	Dap-seq OMalley et al.(2016) WRKY27_colamp_a	0.835	0.644
WRKY65 M07372_2.00	Arabidopsis thaliana	NWWAGTCAACG	CGTTGACTWWN	Dap-seq OMalley et al.(2016) WRKY65_col_a	0.827	0.576
WRKY65 M07373_2.00	Arabidopsis thaliana	NAAAGTCAACGN	NCGTTGACTTTN	Dap-seq OMalley et al.(2016) WRKY65_colamp_a	0.827	0.576
WRKY14 M00731_2.00	Arabidopsis thaliana	NRGTCAAMNN	NNKTTGACYN	PBM Chang et al.(2013) pTH7570	0.825	0.542
WRKY14 M07375_2.00	Arabidopsis thaliana	NAAAGTCAACGNN	NNCGTTGACTTTN	Dap-seq OMalley et al.(2016) WRKY14_col_a	0.825	0.542
WRKY14 M07376_2.00	Arabidopsis thaliana	NAAAGTCAACGNH	DNCGTTGACTTTN	Dap-seq OMalley et al.(2016) WRKY14_colamp_a	0.825	0.542
WRKY29 M02558_2.00	Arabidopsis thaliana	NNNGTCHDNN	NNHDGACNNN	PBM Weirauch et al.(2014) pTH9604	0.823	0.542
WRKY29 M07410_2.00	Arabidopsis thaliana	HAAAGTCAACK	MGTTGACTTTD	Dap-seq OMalley et al.(2016) WRKY29_col_a	0.823	0.542
WRKY29 M07411_2.00	Arabidopsis thaliana	HWWAGTCAAMDNN	NNHKTTGACTWWD	Dap-seq OMalley et al.(2016) WRKY29_colamp_a	0.823	0.542
WRKY22 M02557_2.00	Arabidopsis thaliana	NNNKTMHDNN	NNHDKAMNNN	PBM Weirauch et al.(2014) pTH7320	0.820	0.576
WRKY22 M07400_2.00	Arabidopsis thaliana	AAAAGTCAACKNH	DNMGTTGACTTTT	Dap-seq OMalley et al.(2016) WRKY22_colamp_a	0.820	0.576
WRKY22 M07401_2.00	Arabidopsis thaliana	NAAAGTCAACKNH	DNMGTTGACTTTN	Dap-seq OMalley et al.(2016) WRKY22_col	0.820	0.576
ZAP1 M00982_2.00	Arabidopsis thaliana	NRGTCAAN	NTTGACYN	PBM Lindemose et al.(2014) WRKY1	0.814	0.492
WRKY21 M02553_2.00	Arabidopsis thaliana	NNRGTCAAMN	NKTTGACYNN	PBM Weirauch et al.(2014) pTH7422	0.808	0.542
WRKY21 M07389_2.00	Arabidopsis thaliana	HAAAGTCAACNNH	DNNGTTGACTTTD	Dap-seq OMalley et al.(2016) WRKY21_colamp_a	0.808	0.542
WRKY21 M07390_2.00	Arabidopsis thaliana	HAAAGTCAACK	MGTTGACTTTD	Dap-seq OMalley et al.(2016) WRKY21_col	0.808	0.542
For this family, TFs with SR scores > 0.808* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
LjSGA_025444.2	WRKY	19	77	LDSWAWRKYGKKSIKGTPYPRNYFKCTSSKNCPALKRVEQSNIKSHMFIVTYKGEHSHL

Links
Other WRKY family TFs
Other *Lotus japonicus* TFs

727 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action
S40285_08257	Stachybotrys chlorohalonata	S40285_08257	N
VHEMI02455	Torrubiella hemipterigena	VHEMI02455	N
VHEMI08491	Torrubiella hemipterigena	VHEMI08491	N

LjSGA_025444.2 (Lotus japonicus) WRKY

TF Information

Directly determined binding motifs

Motifs from related TFs

DNA Binding Domains

Links

727 Related TFs

LjSGA_025444.2 **(Lotus japonicus)
WRKY**