CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

Bo1g141310 *(Brassica oleracea)* AP2
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00847 (AP2)	IPR001471	Bo1g141310	T000733_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
DREB2A M06655_2.00	Arabidopsis thaliana	NNNNHDHMACCGMCWYHNNNN	NNNNDRWGKCGGTKDHDNNNN	Dap-seq OMalley et al.(2016) DREB2_col_a	0.756	0.900
DREB2A M06656_2.00	Arabidopsis thaliana	NHNHMACCGMCWTWD	HWAWGKCGGTKDNDN	Dap-seq OMalley et al.(2016) DREB2_colamp_a	0.756	0.900
Q1ESI9_MAIZE M09714_2.00	Zea mays	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$DREB2A_02	0.689	0.840
PK07402.1 M01097_2.00	Cannabis sativa	NVRCCGMCH	DGKCGGYBN	PBM Lambert et al.(2019) pTH11436	0.677	0.800
For this family, TFs with SR scores > 0.677* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Bo1g141310.1	AP2	517	568	CSFRGVRQRVWGKWVAEIREPNRVSRLWLGTFPTAEEAASAYDEAAKAMYGP

Links
Other AP2 family TFs
Other *Brassica oleracea* TFs