CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

Pm011907 *(Prunus mume)* AP2
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00847 (AP2)	IPR001471	Pm011907	T006586_2.00	GigaDB (2015-Oct-22)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
ERF3 M01607_2.00	Arabidopsis thaliana	CGCCGSCR	YGSCGGCG	PBM Weirauch et al.(2014) pTH8109	0.737	0.872
ERF3 M06584_2.00	Arabidopsis thaliana	YHDYCKCCGCCGYHD	HDRCGGCGGMGRHDR	Dap-seq OMalley et al.(2016) ERF3_col_a	0.737	0.872
ERF3 M06585_2.00	Arabidopsis thaliana	NNHHDNHNNYDCCGCCGYCR	YGRCGGCGGHRNNDNHDDNN	Dap-seq OMalley et al.(2016) ERF3_colamp_a	0.737	0.872
ERF7 M01617_2.00	Arabidopsis thaliana	NGCCGNMNNN	NNNKNCGGCN	PBM Weirauch et al.(2014) pTH7606	0.723	0.830
ERF7 M06620_2.00	Arabidopsis thaliana	YHNHYNYYDYCDCCGCCGYCD	HGRCGGCGGHGRHRRNRDNDR	Dap-seq OMalley et al.(2016) ERF7_col_a	0.723	0.830
ERF7 M06621_2.00	Arabidopsis thaliana	NNNHNNHNHHDSCGCCGCCRH	DYGGCGGCGSHDDNDNNDNNN	Dap-seq OMalley et al.(2016) ERF7_colamp_a	0.723	0.830
PK17878.1 M01099_2.00	Cannabis sativa	CGCCGYCR	YGRCGGCG	PBM Lambert et al.(2019) pTH10133	0.702	0.809
For this family, TFs with SR scores > 0.677* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Pm011907	AP2	30	81	VRYRGVRKRPWGRFAAEIRDPWKKTRVWLGTFDSAEDAARAYDAAARILRGP

Links
Other AP2 family TFs
Other *Prunus mume* TFs