CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

Pm018989 *(Prunus mume)* AP2
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00847 (AP2)	IPR001471	Pm018989	T006610_2.00	GigaDB (2015-Oct-22)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
PK07402.1 M01097_2.00	Cannabis sativa	NVRCCGMCH	DGKCGGYBN	PBM Lambert et al.(2019) pTH11436	0.761	0.939
Q1ESI9_MAIZE M09714_2.00	Zea mays	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$DREB2A_02	0.735	0.837
Q8H769_WHEAT M09721_2.00	Triticum aestivum	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$DREB1_01	0.690	0.816
DREB2G M06662_2.00	Arabidopsis thaliana	DCCRCCGCYDYHDYH	DRHDRHRGCGGYGGH	Dap-seq OMalley et al.(2016) At5g18450_col_a	0.682	0.796
For this family, TFs with SR scores > 0.677* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Pm018989	AP2	79	130	CNYRGVRQRTWGKWVAEIREPNRGSRLWLGTFPTALDAALAYDEAAKAMYGP

Links
Other AP2 family TFs
Other *Prunus mume* TFs