CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

LALA0_S01e06304g *(Lachancea lanzarotensis)* APSES
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF04383 (KilA-N)	IPR018004	LALA0_S01e06304g	T012044_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
SWI4 M00004_2.00	Saccharomyces cerevisiae	RACGCGWW	WWCGCGTY	PBM Badis et al.(2008) SWI4_4482	0.651	0.723
SWI4 M07435_2.00	Saccharomyces cerevisiae	DCGCGAAW	WTTCGCGH	PBM, CSA and or DIP-chip Mathelier et al.(2014) MA0401.1	0.651	0.723
SWI4 M08473_2.00	Saccharomyces cerevisiae	DCGCGAAW	WTTCGCGH	Misc DeBoer et al.(2011) YER111C_584	0.651	0.723
SWI4 M09762_2.00	Saccharomyces cerevisiae	Transfac license required	Transfac license required	Transfac Matys et al.(2006) F$SWI4_Q6_01	0.651	0.723
SWI4 M09763_2.00	Saccharomyces cerevisiae	Transfac license required	Transfac license required	Transfac Matys et al.(2006) F$SWI4_Q6	0.651	0.723
For this family, TFs with SR scores > 0.650* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
CEP60245	APSES	49	134	RGFESRIVMRRCLDNWVNITQVFKIASFSKTQRTKILEKESNMVKHEKIQGGYGRFQGTWIPLESAIYLVEKYNVNDVVVSTILHF

Links
Other APSES family TFs
Other *Lachancea lanzarotensis* TFs