CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

ZBED1 *(Macaca mulatta)* BED ZF
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF02892 (zf-BED)	IPR003656	ENSMMUG00000007514	T026078_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
ZBED1 M02771_2.00	Homo sapiens	HTRTCGCGACATR	YATGTCGCGAYAD	SELEX Jolma et al.(2013) ZBED1_1	1.000	1.000
ZBED1 M04056_2.00	Homo sapiens	VTRTCGCGAYAT	ATRTCGCGAYAB	SELEX Yin et al.(2017) ZBED1_eDBD_HT-SELEX	1.000	1.000
ZBED1 M09776_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$DREF_01	1.000	1.000
ZBED1 M04057_2.00	Homo sapiens	MTRTCGCGAYAK	MTRTCGCGAYAK	SELEX Yin et al.(2017) ZBED1_eDBD_Methyl-HT-SELEX	1.000	1.000
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
ENSMMUP00000009862	BED ZF	23	72	SKVWKYFGFDTNAEGCILQWKKIYCRICMAQIAYSGNTSNLSYHLEKNHP

Links
Other BED ZF family TFs
Other *Macaca mulatta* TFs