CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

ENSTRUG00000001493 *(Takifugu rubripes)* bHLH
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00010 (HLH)	IPR001092	ENSTRUG00000001493	T037819_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
Hes1 M01726_2.00	Mus musculus	NVCACGYKNN	NNMRCGTGBN	PBM Weirauch et al.(2014) pTH5059	0.884	0.927
HES1 M04090_2.00	Homo sapiens	VVCACGYGHM	KDCRCGTGBB	SELEX Yin et al.(2017) HES1_eDBD_HT-SELEX	0.884	0.927
HES1 M09822_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$HES1_Q2	0.884	0.927
HES1 M09823_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$HES1_Q3	0.884	0.927
HES1 M09824_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$HES1_Q4	0.884	0.927
HES1 M09825_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$HES1_Q6	0.884	0.927
HES1 M04091_2.00	Homo sapiens	VNYACNYNHN	NDNRNGTRNB	SELEX Yin et al.(2017) HES1_eDBD_Methyl-HT-SELEX	0.884	0.927
For this family, TFs with SR scores > 0.838* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
ENSTRUP00000003434	bHLH	37	94	KKSSKPIMEKRRRARINESLGQLKTLIMEALKKDSSRHSKLEKADILEMTVKHLRNLQ

Links
Other bHLH family TFs
Other *Takifugu rubripes* TFs